Align SDR family oxidoreductase (characterized, see rationale)
to candidate CCNA_03495 CCNA_03495 D-beta-hydroxybutyrate dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Caulo:CCNA_03495 Length = 265 Score = 141 bits (355), Expect = 2e-38 Identities = 84/257 (32%), Positives = 131/257 (50%), Gaps = 13/257 (5%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTDD- 66 L G+ ++T + GIG A + A +G ++ + + + E A ETH ++V Sbjct: 7 LQGQVAIVTGSTSGIGHAMADALAAQGCNIVMNGLGEMNAIERARAEMAETHGVEVLYHG 66 Query: 67 ----------DAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHT 116 D ++A A+ G +D+L N AG + + + WD +N + FH Sbjct: 67 ADMTRPIEIADMVRAAKAEFGELDILVNNAGVQHVAPVEDFPEDKWDLIIAVNLSSAFHA 126 Query: 117 IRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRC 176 +A +P M + G IVNIASA V + AY A+K ++GLTK+VA + GI C Sbjct: 127 TKAAVPIMKEQGRGRIVNIASAHGLVASPF-KSAYVAAKHGIMGLTKTVALEVAQHGITC 185 Query: 177 NAICPGTIESPSLNQRISTQAKETGKSEDEV-RAAFVARQPMGRIGKAEEVAALALYLAS 235 NAICPG +++P + +I+ QAK G SE+ V R +A QP + +++ + LYL S Sbjct: 186 NAICPGFVKTPLVEAQIADQAKARGISEEAVMRDVILASQPTKQFVTFDQLNGMLLYLVS 245 Query: 236 DESNFTTGSIHMIDGGW 252 D G+ + IDGGW Sbjct: 246 DLGASANGAAYQIDGGW 262 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 265 Length adjustment: 24 Effective length of query: 230 Effective length of database: 241 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory