Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate CCNA_02479 CCNA_02479 aryl-alcohol dehydrogenase
Query= BRENDA::P22144 (363 letters) >FitnessBrowser__Caulo:CCNA_02479 Length = 366 Score = 85.5 bits (210), Expect = 2e-21 Identities = 80/266 (30%), Positives = 114/266 (42%), Gaps = 22/266 (8%) Query: 21 DAPEISEPT--DVLVQVKKTGICGSDIHFYAHGRIGNFVLTKPMVLGHESAGTVVQVGKG 78 +A +I P ++LV+V TG+C +D+ R + +P+VLGHE AG V QVG G Sbjct: 18 EALDIEPPRAGEILVRVVATGVCHTDMVM----RDQHLPTPQPVVLGHEGAGVVEQVGPG 73 Query: 79 VTSLKVGDNVAIEPGIPSRF---SDEYKSGHYNLCPHMAFAATPNSKEGEPNPP------ 129 V + VGD+V + R SD + + P A + G Sbjct: 74 VAKVAVGDHVVMTFNSCGRCPSCSDHAPTYCHEFFPRNFMGAREDGSSGLSKGSEVIHAN 133 Query: 130 ----GTLCKYFKSPEDFLVKLPDHVSLE-LGALVEPLSVGVHASKLG-SVAFGDYVAVFG 183 + Y E VK+ LE LG L + G A V G + VFG Sbjct: 134 IFGQSSFATYALCHERNAVKVDKTAPLERLGPLGCGVMTGAGAVMNALKVPAGRSLVVFG 193 Query: 184 AGPVGLLAAAVAKTFGAKGVIVVDIFDNKLKMAKDIGAATHTFNSKTGGSEELIKAFGGN 243 AG VGL A AK GA +I +DI +L +A ++G A H N GG E I+A G Sbjct: 194 AGAVGLSAVLAAKAIGAGPIIAIDINPERLALALELG-ADHALNGAEGGVVEKIQAITGT 252 Query: 244 VPNVVLECTGAEPCIKLGVDAIAPGG 269 + ++ T ++ VD + G Sbjct: 253 GAHFSIDTTANLKVMRQAVDCLGARG 278 Lambda K H 0.318 0.138 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 363 Length of database: 366 Length adjustment: 29 Effective length of query: 334 Effective length of database: 337 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory