Align xylono-1,5-lactonase (EC 3.1.1.110) (characterized)
to candidate CCNA_01882 CCNA_01882 SMP-30/gluconolaconase/LRE-like protein
Query= metacyc::MONOMER-20628 (289 letters) >FitnessBrowser__Caulo:CCNA_01882 Length = 293 Score = 127 bits (320), Expect = 2e-34 Identities = 98/289 (33%), Positives = 133/289 (46%), Gaps = 23/289 (7%) Query: 1 MTAQVTCVWDLKATLGEGPIWHGDT--LWFVDIKQRKIHNYHPATGERFSFDAPDQVTFL 58 MT V + + LGE P+W D L++VD I Y P T E+ S AP + + Sbjct: 1 MTFTVEIIGKERCRLGESPLWDADAGVLYWVDSMAPAIWRYDPFTSEQRSIPAPKPIGSV 60 Query: 59 APIVGATG-FVVGLKTGIHRFHPATG-FSLLLEVEDAALNNRPNDATVDAQGRLWFGTMH 116 ++G G + GL G++R TG F+ + + A R ND D QGR GTM Sbjct: 61 --VLGRPGELIAGLADGVYRVQLDTGAFTPIALPDTLAPIERFNDGKADRQGRFVTGTMA 118 Query: 117 -DGEENNSGSLYRMDLTGVARM--DRDICITNGPCVSPDGKTFYHTDTLEKTIYAFDL-A 172 E G LYR G + I I N C SP G T Y D+L ++AF Sbjct: 119 MHNETGRIGKLYRFSAGGAWEVLPTEPIEIANSTCFSPSGDTLYFADSLRHMVWAFSYDP 178 Query: 173 EDGLLSNKRVFVQFALGDDVYPDGSVVDSEGYLWTALWGGFGAVRFSPQGDAVTRIELPA 232 + G + KR F G + PDG+ VD+EG++W AL +R SP G +E PA Sbjct: 179 KTGAVGEKRDFFD-TTGFNSAPDGATVDAEGHIWLALVQAQKLIRISPDGRLDRVVESPA 237 Query: 233 PNVTKPCFGGPDLKTLYFTTARKGLSDETLAQYPLAGGVFAVPVDVAGQ 281 P + P FGG DL LY T+ +SD +GG VD +G+ Sbjct: 238 PFCSCPAFGGEDLDILYVTS----ISD--------SGGRLKTDVDASGR 274 Lambda K H 0.321 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 293 Length adjustment: 26 Effective length of query: 263 Effective length of database: 267 Effective search space: 70221 Effective search space used: 70221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory