Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate CCNA_03097 CCNA_03097 aldo/keto reductase family protein
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Caulo:CCNA_03097 Length = 333 Score = 139 bits (349), Expect = 1e-37 Identities = 92/269 (34%), Positives = 142/269 (52%), Gaps = 11/269 (4%) Query: 26 VALGTWAIGGWMWGGTDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIKGQRD 85 + LG +G + + K + RA++LG+ DTA YG EE+VG+ +K RD Sbjct: 15 IGLGCMGMGQVYGTALETGDAFKLMARAVELGVTFFDTAEVYGPFANEELVGQGLKPFRD 74 Query: 86 NLIIATKVGLDWTLTPD---QSMRR----NSSASRIKKEIEDSLRRLGTDYIDLYQVHWP 138 ++IATK G D + P+ Q M R NS I+ E SL+RLG + IDL+ H Sbjct: 75 QVVIATKFGFD--IGPEDLGQGMARVRGVNSRPEHIRSVAEASLKRLGIETIDLFYQHRV 132 Query: 139 DPLVPIEETATILEALRKEGKIRSIGVSNYSVQQMDEFKKYAELAVSQSPYNLFEREIDK 198 DP VPIE+ A ++ L EGK++ G+S + + +A QS Y+L+ RE++ Sbjct: 133 DPAVPIEDVAGTVKDLIAEGKVKHFGLSEAGAATIRKAHAIQPVAALQSEYSLWFRELEA 192 Query: 199 DILPYAKKNDLVVLGYGALCRGLLSGRMTADRAFTGDDLRKTDPKFQKPRFEHYLAAVEE 258 +ILP ++ + ++ Y L RG L+G + A+ G D RK P+FQ + L+ VE Sbjct: 193 EILPTLRELKIGLVPYSPLGRGFLAGAVKAETMGEG-DFRKGLPRFQGEALQKNLSLVEA 251 Query: 259 LKKLAKEHYNKSVLALAIRWMLEQGPTLA 287 L +A + + LA+ W+L QG +A Sbjct: 252 LSAIAADK-GVTPAQLALAWILHQGHDIA 279 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 333 Length adjustment: 28 Effective length of query: 312 Effective length of database: 305 Effective search space: 95160 Effective search space used: 95160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory