Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate Echvi_1073 Echvi_1073 Acyl-CoA dehydrogenases
Query= SwissProt::Q2LQN9 (414 letters) >FitnessBrowser__Cola:Echvi_1073 Length = 599 Score = 184 bits (466), Expect = 8e-51 Identities = 123/392 (31%), Positives = 195/392 (49%), Gaps = 26/392 (6%) Query: 36 ELTEEQKLLMEMVRNLAVREIAPRAIEID--ENHSFPVHARDLFADLGLLSPLVPVEYGG 93 E TEEQ+++ + ++ EI P++ EID +N +LGLL VP EY G Sbjct: 28 EFTEEQRMMAQACQDFIDTEILPKSEEIDSMKNPDLVPAILKKAGELGLLGISVPEEYQG 87 Query: 94 TGMDITTFAMVLEEIGKVCASTALMLLAQADGMLSIILDGSPALKEKYLPRFGEKSTLMT 153 GM T ++ + IG + + G L I+ G+ K+KYLP+ Sbjct: 88 LGMSFNTSMLIADIIGAAGSFSTTYGAHTGIGTLPILYYGTEEQKKKYLPKLAT-GEWAA 146 Query: 154 AFAATEPGAGSDLLAMKTRAV--KKGDKYVINGQKCFITNGSVADILTVWAYTDPSKGAK 211 + TEP AGSD + KT+A + G Y++NGQK +I+NG AD+ V+A K Sbjct: 147 CYCLTEPDAGSDANSGKTKATLTEDGKHYLLNGQKMWISNGGFADLFIVFAKIGEDKN-- 204 Query: 212 GMSTFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLVGEEGKGFAYLMGAL 271 ++ F+VE+ G+ EKKMG++G ++FF D +VP EN++ + GF + L Sbjct: 205 -LTAFIVEKDFGGITMNEEEKKMGIKGSSTRQVFFNDCKVPVENMLSDRQNGFKIAVNIL 263 Query: 272 SINRVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAAR-LL 330 +I RV + +G + ++ A+Q++ ER+QFG I I+ +A+MA + + L Sbjct: 264 NIGRVKLGAGVLGGCRQVIKNALQYSSERKQFGVSINTFGAIKSKLAEMAVKTYVSESLC 323 Query: 331 VRKATTLLDAKD---------KRGPLIG--------GMAKTFASDTAMKVTTDAVQVMGG 373 R + D D + L G +AK S+ V VQ+ GG Sbjct: 324 YRLGQNIEDRIDALMASGMEANQAKLKGVEQFAMECAIAKIHGSEVLDYVVDQGVQIYGG 383 Query: 374 SGYMQEYQVERMMREAKLTQIYTGTNQITRMV 405 GY + +ER R+A++++IY GTN+I RM+ Sbjct: 384 MGYSADAPMERAYRDARISRIYEGTNEINRML 415 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 599 Length adjustment: 34 Effective length of query: 380 Effective length of database: 565 Effective search space: 214700 Effective search space used: 214700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory