Align Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate Echvi_4304 Echvi_4304 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)
Query= reanno::pseudo3_N2E3:AO353_17230 (266 letters) >FitnessBrowser__Cola:Echvi_4304 Length = 270 Score = 209 bits (532), Expect = 5e-59 Identities = 113/251 (45%), Positives = 151/251 (60%), Gaps = 2/251 (0%) Query: 10 ELKYQLDGPEHAPVLVLSNSLGTNLHMWDVQIPAFTKHFRVLRFDTRGHGRSLVTPGPYS 69 E+ Y++DG PVLVLSNS+ T+L MWD Q+ AF K +R+LRFDTRGHG S G YS Sbjct: 19 EIVYKIDGEVTNPVLVLSNSIATDLAMWDGQVEAFCKSYRLLRFDTRGHGLSESPVGDYS 78 Query: 70 IEQLGRDVLALLDALNIERAHFCGLSMGGLIGQWLGINAGERLHKLVVCNTAAKIGDPSV 129 + +L +DV+ L+D L IE+AHFCGLS+GG IGQWLG++ RL KL++ NT+ +G ++ Sbjct: 79 VARLAKDVIELMDYLGIEKAHFCGLSLGGFIGQWLGVHVPHRLDKLILANTSPYLGPDTI 138 Query: 130 WNPRIETVLRDGPAAMVALRDASIARWFTPDFAQANPAVAKQITDMLAATSPQGYAANCA 189 WN I +LR+G + M + I WF M+ +TSP G A A Sbjct: 139 WNENIH-LLRNG-SDMSHFEELFINGWFPKQMINNQKNRVVPFRKMILSTSPIGLAGAYA 196 Query: 190 AVRDADFREQLASITVPTLVIAGTEDAVTPPSGGRFIQERVRGAEYAEFYAAHLSNVQAG 249 AVRDADFR+ A I TL++AG D VT P + + E +RGA HLSN++ Sbjct: 197 AVRDADFRKTNALIPNKTLILAGEHDQVTKPEHSKLMHEVIRGATLKVLPVVHLSNIERI 256 Query: 250 SAFSDRVLSFL 260 + F VL FL Sbjct: 257 NEFERLVLQFL 267 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 270 Length adjustment: 25 Effective length of query: 241 Effective length of database: 245 Effective search space: 59045 Effective search space used: 59045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory