Align Lactate utilization protein A (characterized)
to candidate Echvi_1569 Echvi_1569 Fe-S oxidoreductase
Query= SwissProt::O07020 (238 letters) >FitnessBrowser__Cola:Echvi_1569 Length = 245 Score = 190 bits (482), Expect = 3e-53 Identities = 104/246 (42%), Positives = 145/246 (58%), Gaps = 20/246 (8%) Query: 1 MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK 60 M+V LF+ C VD F +AT+ELLE+ G +V +P Q CCGQP NSGY K + + Sbjct: 1 MRVGLFIPCYVDQFYPGAAQATLELLEKYGMDVVYPLSQTCCGQPMANSGYERYGKASSE 60 Query: 61 RMIETFQDSEYVVSPSGSCTTMFREYPHLFQDDPKWADKAKKLADKTYELTDFIVNVLGV 120 +E F + EY+V+PSGSCT ++ H+ PK A+ A K YEL +F+ ++L V Sbjct: 61 LFLENFGEFEYIVAPSGSCTLHVKD--HVL---PKTAE-----APKIYELCEFLTDILKV 110 Query: 121 EDVGATLHTKATLHTSCHMTRLLGVRK----------EPMKLLSHVKGLQFTELPGKHNC 170 + V A+ K H+SCH R L + K +P+ LLS VKG++ EL K C Sbjct: 111 DHVDASFPYKVGFHSSCHGLRGLRLAKCSERMDEEFNKPLSLLSKVKGIEMVELDRKDEC 170 Query: 171 CGFGGTFSVKMAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVMH 230 CGFGGTF+V +S M ++++ + G EVL GAD CLM++ G L R+ +KVMH Sbjct: 171 CGFGGTFAVAEEAVSVTMGNDRIADHQRNGVEVLTGADMSCLMHMQGLLKRQKSPIKVMH 230 Query: 231 IAEVLN 236 IAE+LN Sbjct: 231 IAEILN 236 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 245 Length adjustment: 23 Effective length of query: 215 Effective length of database: 222 Effective search space: 47730 Effective search space used: 47730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory