Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate Echvi_4044 Echvi_4044 ABC-type transport system involved in resistance to organic solvents, ATPase component
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Cola:Echvi_4044 Length = 249 Score = 101 bits (251), Expect = 2e-26 Identities = 66/218 (30%), Positives = 116/218 (53%), Gaps = 7/218 (3%) Query: 17 DVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQ 76 ++ +L G++ + GE V V+G +G GKS L K + GLLT +G + G+ ++ LG+ Sbjct: 17 ELDVLMGVDLDLYKGENVVVLGKSGTGKSVLIKIMVGLLTQDEGTMNVLGKEVSNLGAKD 76 Query: 77 I--VRRGMCYVPQVCNVFGSLTVAENLDMGAFLH-QGPTQTLKDRIYTMFPK---LAQRR 130 + +R + + Q ++ S+TV ENL+ + +G ++T KD++ + L+Q Sbjct: 77 LNELRLKIGFSFQASALYDSMTVRENLEFPLVRNVKGLSRTEKDKMVEEVLEAVGLSQTI 136 Query: 131 NQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINAT-GKAI 189 NQ LSGG+R+ + + R L+L P+++L DEP+A L PI D+ I + + Sbjct: 137 NQMPSELSGGQRKRIGIARTLILKPEIMLYDEPTAGLDPITCSDINNLINEVRENYNTSS 196 Query: 190 ILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDP 227 I++ + A DR VL +G+ EG + + P Sbjct: 197 IIITHDLTCARDTGDRVAVLLDGQFGAEGKFEEVFKTP 234 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 249 Length adjustment: 24 Effective length of query: 216 Effective length of database: 225 Effective search space: 48600 Effective search space used: 48600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory