Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate Echvi_3936 Echvi_3936 Lactate dehydrogenase and related dehydrogenases
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__Cola:Echvi_3936 Length = 330 Score = 163 bits (413), Expect = 5e-45 Identities = 100/289 (34%), Positives = 159/289 (55%), Gaps = 23/289 (7%) Query: 47 DALVTLVTDKVDKELLENAPK--LKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDAT 104 DA+ VTD + +LE + +K +A + G++++D+ A + G+ V P A Sbjct: 44 DAVAIFVTDNGSRPVLEKLQQFGVKYLALRSAGFNHVDLSAAEELGLKVARVPEYSPAAI 103 Query: 105 ADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQA 164 A+ AL+LA+ R++V+A VR + + +G+ ++GKT+GI G G+IG Sbjct: 104 AEHTVALMLALNRKLVKAHNRVRDLNFSLDGL-------VGFDMEGKTIGIAGTGKIGSK 156 Query: 165 LAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGE 224 +AK GFG +++ Y + E+ EYVDF+TL ESD I+LH+PL+ + +MI Sbjct: 157 VAKTLSGFGCRLLAYDPYINESLKAELEIEYVDFKTLCTESDIITLHLPLSSSSQYMINS 216 Query: 225 KELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEP--YYNE------- 275 ++ MK +LINTSRGA+V+T +I+ALK G I G+DV+EEE ++ + Sbjct: 217 SSMEDMKKGVMLINTSRGALVNTKEVIEALKTGKIGSFGMDVYEEEEDLFFEDHSEDILQ 276 Query: 276 -----ELFKLKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPN 319 L +NV++ H T EA E +A + A NL +AK E P+ Sbjct: 277 DDVIARLLTFQNVLITSHQAFLTKEALEKIAGVTAFNLNCWAKNESSPH 325 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 330 Length adjustment: 28 Effective length of query: 303 Effective length of database: 302 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory