Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate Echvi_2055 Echvi_2055 dihydroxy-acid dehydratase
Query= reanno::Smeli:SM_b20890 (579 letters) >FitnessBrowser__Cola:Echvi_2055 Length = 561 Score = 312 bits (799), Expect = 3e-89 Identities = 190/535 (35%), Positives = 300/535 (56%), Gaps = 26/535 (4%) Query: 44 RPIIGICNTWSELTPCNAHLRDLAERVKRGVYEA--GGFPVEFPVFSTGESTLRPTAMMF 101 +P +G+ + E PCN HL AE +K +A GF S G+S + + M + Sbjct: 37 QPFVGVASCGYESNPCNMHLNSFAEDIKASTNQADLSGFIFNTIGISDGQS-MGTSGMRY 95 Query: 102 ----RNLAAMDVEESIRGNPVDGVVLLGGCDKTTPSLLMGAASVDIPAIVVSGGPMLNGK 157 R + A +E I G+ DGVV + GCDK P ++MG V+ P I+V GG + +G Sbjct: 96 SLPSREVIADSIESFILGHSFDGVVTIPGCDKNMPGVVMGMLRVNRPGIMVFGGTIRSGN 155 Query: 158 WRGKDVGSGTAIWQFSEMVKSGEMSLEEFMDAEQGMARSAGSCMTMGTASTMASMAEALG 217 ++G+ + +A + + + +G++S E++M + AG+C M TA+TM+S EA+G Sbjct: 156 YKGEKLNIVSAFEAYGKKI-NGQISDEDYMGVIKNACPGAGACGGMYTANTMSSAIEAMG 214 Query: 218 MTLSGNAAIPAVDARRRVISQLTGRRIVEMVKEDLKPSDILTKEAFENAIRVNGAVGGST 277 ++L +++ PA +R + G+ I +++ D+KP DI+TK++ ENA+RV A+GGST Sbjct: 215 LSLPFSSSYPATSKEKREECKNIGKYIKQLLALDIKPKDIITKKSLENAVRVTVALGGST 274 Query: 278 NAVLHLLALAGRVGVDLSLDDWDRLGRDVPTIVNLQPSGKYLMEEFYYAGGLPVVIKAVA 337 NA LH+LA+A G+D +L+D+ R+ + P + + +PSGK++ME+ Y GGLP +K Sbjct: 275 NAALHILAIARTAGIDFTLEDFKRINAETPVLGDFKPSGKFMMEDLYEMGGLPAFLKYFL 334 Query: 338 EMGLLHNDAITVSGDTI---WNDVKGVVNYNEDVILPREKALTKSGGIAVLRGNLAPRGA 394 GLLH D +TV+G T+ D+ V E VI P + + SG + VL GNLAP GA Sbjct: 335 NEGLLHGDCLTVTGKTMAENLEDIDPVKPSKESVIHPLDNPIKPSGHLCVLHGNLAPEGA 394 Query: 395 VLKPSAASPHLMQHKGRAVVFESIEDYHARINREDLDIDETCIMVLKYCGPKGYPGMAEV 454 V K S G A VF+ ++ A ++ +I + ++V++Y GPKG PGM E+ Sbjct: 395 VAKISGKEG--KSFTGTAKVFD--DEPSANAAMKNKEIQKGDVVVIRYVGPKGGPGMPEM 450 Query: 455 GNMGLPPKVLKKGI---TDMIRISDARMSGTAYGTVILHTAPEAAEGGPLALVENGDLIE 511 L P + G +D+ I+D R SG +G V+ H PEA GGP+ L+++GD+I Sbjct: 451 ----LKPTSIIIGAGLGSDVALITDGRFSGGTHGFVVGHVTPEAYLGGPIGLLKDGDVIT 506 Query: 512 VDIPNRTLHLHVSDEELARRRAAWVSPVKPLTGGYGGL--YIKTVMQADAGADLD 564 +D + + + VS+ E A R+ W + K L+ G L Y++ V A G D Sbjct: 507 IDAESLEIRVDVSEAEFAERKKNWKN--KDLSHLQGTLKKYVQLVSTASEGCVTD 559 Lambda K H 0.318 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 884 Number of extensions: 44 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 579 Length of database: 561 Length adjustment: 36 Effective length of query: 543 Effective length of database: 525 Effective search space: 285075 Effective search space used: 285075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory