Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate Echvi_2123 Echvi_2123 ABC-type spermidine/putrescine transport systems, ATPase components
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__Cola:Echvi_2123 Length = 318 Score = 148 bits (374), Expect = 2e-40 Identities = 95/258 (36%), Positives = 153/258 (59%), Gaps = 19/258 (7%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 M+ L + +V+K Y D G +A+E+ SL + G + +VG SG GKS+ LR++AGLE Sbjct: 1 MSYLKVSEVSKRY-DAGS---LALEDFSLQVKRGGVVSMVGESGSGKSSLLRIIAGLEVQ 56 Query: 61 TEGELRLED-RVLNG----VSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDE 115 + G + L D ++LN V D +I ++ Q Y LYP+ +V N++ L L D+ Sbjct: 57 SAGVVHLGDQKILNPAQKLVPGYD-EIQLIHQEYKLYPNSTVEENIARPL-----LLYDK 110 Query: 116 I--RQRVEETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAK 173 ++R E ++L + D+KP QLSGGQQQ+VA+GRA+ +PEV L+DEP S+LDA Sbjct: 111 AYQKERTAEILELLSLRAFKDKKPRQLSGGQQQKVAIGRALSIEPEVLLLDEPFSSLDAI 170 Query: 174 LRAEMRTELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNN 233 + ++ EL+ + L VT ++VTHD +A+ M + + ++ G+L Q G + + +P + Sbjct: 171 QKRDLIEELKEIFDALEVTVIFVTHDVDDALLMSEELLIIQKGKLLQQGNVREVFRKPAS 230 Query: 234 LFVAGFIGEPSMNLFDGS 251 +VA G +NL G+ Sbjct: 231 AYVARLFG--YLNLIPGA 246 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 318 Length adjustment: 29 Effective length of query: 354 Effective length of database: 289 Effective search space: 102306 Effective search space used: 102306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory