GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astC in Echinicola vietnamensis KMM 6221, DSM 17526

Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate Echvi_3848 Echvi_3848 Ornithine/acetylornithine aminotransferase

Query= reanno::Marino:GFF3099
         (404 letters)



>lcl|FitnessBrowser__Cola:Echvi_3848 Echvi_3848
           Ornithine/acetylornithine aminotransferase
          Length = 381

 Score =  214 bits (544), Expect = 4e-60
 Identities = 143/380 (37%), Positives = 200/380 (52%), Gaps = 20/380 (5%)

Query: 24  IIPVRGEGSRIWDQEGREFIDLQGGIAVTCLGHSHPGLVGALHDQAEKIWHLSNVMTNEP 83
           + PV+  GS IWD +G E++DL GG AV  +GHSHP     + +Q + I   SN +    
Sbjct: 12  VTPVKASGSTIWDDQGNEYLDLYGGHAVISIGHSHPHYTKRIKEQLDNIAFYSNSVQIPI 71

Query: 84  ALRLAKTLCDLTFAER--VFFANSGAEANEAAFKLARRYAWEHHGKEKNEIISFKNSFHG 141
              LA  L  L+      +F  NSGAEANE A KLA           K   I+F   FHG
Sbjct: 72  QKELATKLGQLSGYPDYDLFLCNSGAEANENALKLAS------FETGKKGFIAFTKGFHG 125

Query: 142 RTLFTVSVGGQPKYLEGFEPAPGGIHHAEFNDLESVKKLISKEKTCAIVVEPIQGEGGVM 201
           RT   V++   PK +  F  A  G+H   FNDLE+V+K ++      ++VE IQG GG+ 
Sbjct: 126 RTSGAVALTDNPKIIAPFN-AHEGVHILPFNDLEAVEKQLATGTIAGVIVEGIQGVGGIQ 184

Query: 202 PGDQAFLQGLRDLCDENDALLVFDEVQSGVGRSGHFYAYQ-MYGVVPDILSSAKGLGGGF 260
             D AFL GL  L  +  A L+ DEVQSG  RSG F+A+Q + G+ PD+++ AKG+G GF
Sbjct: 185 VPDPAFLLGLSALTKQYGAKLILDEVQSGYARSGKFFAHQWVEGLKPDLITVAKGMGNGF 244

Query: 261 PVAAMLTTAKVAASLGVGTHGSTYGGNALACAVAQRVVDTVSQPEILKGVKARSDKLRKG 320
           P+  +L + +  AS G+   G+T+GGN LACA A  V++ + +  ++           K 
Sbjct: 245 PIGGVLISPEFKASHGL--LGTTFGGNHLACAAALAVLEVIDEENLITAAAENG----KA 298

Query: 321 MMDIGERYGVFTEVRGAGLLLGCVL-TEKWQGKAKDFLNAGLEEGVMVLVAGANVIRLAP 379
           +M   E+    TEVRG GL++G  L TE    +A       +  G      G + IRL P
Sbjct: 299 IMAALEKVAGVTEVRGKGLMIGFDLATEAGPVRAALIHEHKIFTG---SAGGKHTIRLLP 355

Query: 380 SLIIPEPDIELALERFEAAV 399
            L I    + L LE+ E  +
Sbjct: 356 PLNIEPKALTLFLEKLETVL 375


Lambda     K      H
   0.318    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 406
Number of extensions: 37
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 381
Length adjustment: 31
Effective length of query: 373
Effective length of database: 350
Effective search space:   130550
Effective search space used:   130550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory