GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Echinicola vietnamensis KMM 6221, DSM 17526

Align Probable 4-aminobutyrate aminotransferase; EC 2.6.1.19; (S)-3-amino-2-methylpropionate transaminase; EC 2.6.1.22; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT (uncharacterized)
to candidate Echvi_3848 Echvi_3848 Ornithine/acetylornithine aminotransferase

Query= curated2:P94427
         (436 letters)



>lcl|FitnessBrowser__Cola:Echvi_3848 Echvi_3848
           Ornithine/acetylornithine aminotransferase
          Length = 381

 Score =  179 bits (454), Expect = 1e-49
 Identities = 130/405 (32%), Positives = 206/405 (50%), Gaps = 48/405 (11%)

Query: 34  VKGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYI 93
           VK  G+ ++D  G  ++D  G    +++GHSHP   + +K Q + +     N +  P   
Sbjct: 15  VKASGSTIWDDQGNEYLDLYGGHAVISIGHSHPHYTKRIKEQLDNIAFYS-NSVQIPIQK 73

Query: 94  ELAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMS 153
           ELA KL G   G  +      NSGAEA ENA+K+A   T ++G ++FT+GFHGRT+  ++
Sbjct: 74  ELATKL-GQLSGYPDYDLFLCNSGAEANENALKLASFETGKKGFIAFTKGFHGRTSGAVA 132

Query: 154 MTSKVKPYKFGFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIAS--VAPE 211
           +T   K               APF             +++ + I  FND       +A  
Sbjct: 133 LTDNPKII-------------APF------------NAHEGVHILPFNDLEAVEKQLATG 167

Query: 212 TVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFD 271
           T+A V++E +QG GG  +P   F+  +++  K++G   + DE+Q+G+AR+G +FA +  +
Sbjct: 168 TIAGVIVEGIQGVGGIQVPDPAFLLGLSALTKQYGAKLILDEVQSGYARSGKFFAHQWVE 227

Query: 272 -VVPDLITVSKSLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEE 330
            + PDLITV+K +  G P+ GV+   E    A+ G LG T+ G+ L CAAALAVL++I+E
Sbjct: 228 GLKPDLITVAKGMGNGFPIGGVLISPEF--KASHGLLGTTFGGNHLACAAALAVLEVIDE 285

Query: 331 EGLNERSEEIGKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKAAAI- 389
           E L   + E GK I        ++   + ++R  G M   ++           T+A  + 
Sbjct: 286 ENLITAAAENGKAIMAAL----EKVAGVTEVRGKGLMIGFDLA----------TEAGPVR 331

Query: 390 AAYANQNGLLLLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGL 434
           AA  +++ +   +AG   + IR L PL I    L   L  LE  L
Sbjct: 332 AALIHEHKIFTGSAG-GKHTIRLLPPLNIEPKALTLFLEKLETVL 375


Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 438
Number of extensions: 25
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 436
Length of database: 381
Length adjustment: 31
Effective length of query: 405
Effective length of database: 350
Effective search space:   141750
Effective search space used:   141750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory