Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate Echvi_2204 Echvi_2204 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Cola:Echvi_2204 Length = 240 Score = 131 bits (329), Expect = 1e-35 Identities = 81/223 (36%), Positives = 122/223 (54%), Gaps = 8/223 (3%) Query: 1 MISIKSINKWY----GDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKG 56 +I K I K Y Q L + ++ KGE + GPSGSGKSTL+ + L+ G Sbjct: 4 IIETKEIKKTYVMGAEKVQALKSVTIDIIKGEYVAFMGPSGSGKSTLMNIIGCLDTPTAG 63 Query: 57 DIVVDGTSIADPKTN-LPKLRSR-VGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEAT 114 + +++ ++ N L ++R++ +G VFQ F L P T EN+ + I G SK + Sbjct: 64 NYILNNKDVSHMTENELAEIRNKEIGFVFQTFNLLPRATCLENVALPLIYA-GYSKSDRE 122 Query: 115 KKGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNE 174 K L+ VGL H P +LSGGQ+QRVAIARAL DP ++L DEPT LD + + Sbjct: 123 DKAFLALKSVGLEDRIHHKPNELSGGQRQRVAIARALVNDPSIILADEPTGNLDTKTSYD 182 Query: 175 VLDVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIED 217 ++++ +L +G T++ VTHE A A R++ + G + D Sbjct: 183 IMNLFDELHQKGNTIIMVTHEDDIAH-YAHRIVRLRDGLVETD 224 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 240 Length adjustment: 23 Effective length of query: 221 Effective length of database: 217 Effective search space: 47957 Effective search space used: 47957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory