Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 142 bits (357), Expect = 1e-38 Identities = 80/210 (38%), Positives = 128/210 (60%), Gaps = 9/210 (4%) Query: 19 DCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDIVVDGTSIADPK--TNLPKLR 76 D + +GE I + GPSGSGK++ ++ ++ L KG + V+G D N+ R Sbjct: 20 DIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLSVNGEQWFDASFGKNVSPGR 79 Query: 77 SRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATKKGLQLLERVGLSAHAHKHPGQ 136 ++G +FQ + LFP++T+ EN+ A L +K++A ++LLE +GL P Sbjct: 80 RKLGYLFQDYSLFPNMTVKENIAFA----LKNAKDKAYL--MELLESMGLLHLQDTLPKH 133 Query: 137 LSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMVQLAHE-GMTMMCVTHE 195 LSGGQQQRVA+ARALA+ P ++L DEP SALDP M ++ + ++ + + +T + V+H+ Sbjct: 134 LSGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQEYILAIHRKYALTTILVSHD 193 Query: 196 MGFARKVADRVIFMDQGKIIEDCKKEEFFG 225 G K++DR+I +D GK++ C +EFFG Sbjct: 194 AGEIIKLSDRIIELDHGKVLRQCTPKEFFG 223 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 290 Length adjustment: 25 Effective length of query: 219 Effective length of database: 265 Effective search space: 58035 Effective search space used: 58035 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory