Align L-asparaginase (EC 3.5.1.1) (characterized)
to candidate Echvi_0080 Echvi_0080 L-asparaginases, type I
Query= reanno::Pedo557:CA265_RS25090 (339 letters) >FitnessBrowser__Cola:Echvi_0080 Length = 358 Score = 315 bits (807), Expect = 1e-90 Identities = 157/338 (46%), Positives = 235/338 (69%), Gaps = 3/338 (0%) Query: 2 TKILIIYTGGTIGMVNDPTNGMLIPFDFQQIKENVPELSRLDYDLDVHSFNPVLDSSNMD 61 + +LIIYTGGT+GM D + G L+PF+F QI E +P L L+ + V SF +DSSN++ Sbjct: 18 SSVLIIYTGGTLGMAYDES-GALVPFNFGQIMEKIPNLGNLNIAITVISFPEPIDSSNVN 76 Query: 62 PEIWKTLAELVYHKYDAYDGFVILHGSDTMAFTASALSFMLENLAKPVVLTGSQLPIGEI 121 + W +A ++Y YD YDGFV+LHG+DTMA++AS LSFML+ L+KPV+ TG+QLPI + Sbjct: 77 MQHWVDMAYIIYENYDTYDGFVVLHGTDTMAYSASMLSFMLKGLSKPVIFTGAQLPISAM 136 Query: 122 RTDAKENLITALEIAATKEDGKALFPEVCIYFDAQLFRGNRSIKYNSEKFEAFRSPNYPI 181 R+DA+ENL+T+LEIA ++ +GK + PEVCI+F+ L RGNR+ K S F+AF S NYP Sbjct: 137 RSDARENLMTSLEIAISQANGKPIVPEVCIFFNHMLLRGNRAKKMQSVHFDAFESENYPP 196 Query: 182 LAEAGVHLQFHRNYILKATEG-ELKLHTNFNSNIGVLKLYPGITPQAVQAITDSK-VDAI 239 LAE+G+ + ++ I EG +LK + + +LKL+PGIT + + + K + + Sbjct: 197 LAESGIVIDYNYAAIKPYKEGVQLKYLNKLDKRVMILKLFPGITAEVIDSCFSIKGLRGV 256 Query: 240 ILETFGSGNTTTAQWFLDSLRQAILNGKIIIDISQCKKGSVQLGRYETSRELLKMGILSG 299 +LET+GSGN+ T WF++++R+A+ G II+++SQC G V GRYETS+EL ++G+LSG Sbjct: 257 VLETYGSGNSPTEPWFIETVRKAVDRGIIILNVSQCNGGRVIQGRYETSKELKRLGVLSG 316 Query: 300 YDLTFEATVTKLMFVMGLGLSIEESRKLMEESLRGELT 337 D+T EA + K+MF++ +E R+ + L GE++ Sbjct: 317 GDITSEAAICKMMFLLANETDEDEIRRKLITPLAGEMS 354 Lambda K H 0.319 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 358 Length adjustment: 29 Effective length of query: 310 Effective length of database: 329 Effective search space: 101990 Effective search space used: 101990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory