Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate Echvi_1582 Echvi_1582 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::P0AAG3 (241 letters) >FitnessBrowser__Cola:Echvi_1582 Length = 225 Score = 137 bits (344), Expect = 2e-37 Identities = 84/225 (37%), Positives = 135/225 (60%), Gaps = 13/225 (5%) Query: 1 MITLKNVSKWYGH----FQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQG 56 +++++NVSK Y VL D + VK G+ + + GPSGSGK+TL+ GL+ G Sbjct: 3 ILSIENVSKIYQSGSRTLTVLEDINLSVKAGDSIAIVGPSGSGKTTLLGLCAGLDSASSG 62 Query: 57 EITVDGIVVNDKKTDL-AKLRSR-VGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAR 114 + ++G + D A +RS+ +G +FQ+F+L P L+ +EN+ V + + + A+ Sbjct: 63 SVALNGHRLEGLSEDQRAAVRSQEIGFIFQNFQLLPTLTALENV---MVPLELKKRKDAK 119 Query: 115 EKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINE 174 +KA +LL++VGL +P QLSGG+QQRV+IARA +P + DEPT LD E E Sbjct: 120 QKATELLQQVGLGDRMTHYPTQLSGGEQQRVSIARAFANEPKILFADEPTGNLDTE-TGE 178 Query: 175 VLDVMVELANE--GMTMMVVTHEMGFARKVANRVIFMDEGKIVED 217 +++ ++ N+ G T+++VTH+ A K NR+I + GKI E+ Sbjct: 179 LIETLIFDLNKALGTTLILVTHDTDLAAK-TNRIIHIKGGKIQEE 222 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 225 Length adjustment: 23 Effective length of query: 218 Effective length of database: 202 Effective search space: 44036 Effective search space used: 44036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory