Align ATPase (characterized, see rationale)
to candidate Echvi_3653 Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Cola:Echvi_3653 Length = 290 Score = 136 bits (343), Expect = 4e-37 Identities = 74/224 (33%), Positives = 135/224 (60%), Gaps = 9/224 (4%) Query: 41 VSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRL--SHDRRDIATIRQ 98 + LT+ +GE + + GPSGSGK++ LR ++ L + +G + + G + + ++++ R+ Sbjct: 21 IKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLSVNGEQWFDASFGKNVSPGRR 80 Query: 99 EVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPGQL 158 ++G +FQ ++LFP++TV +N+ A A+ +A +LLE + + D P L Sbjct: 81 KLGYLFQDYSLFPNMTVKENIAFALKN------AKDKAYLMELLESMGLLHLQDTLPKHL 134 Query: 159 SGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASE-GMTMLVATHEV 217 SGGQQQRVA+ARALA++P ILL DEP SALDP M ++ + + + + +T ++ +H+ Sbjct: 135 SGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQEYILAIHRKYALTTILVSHDA 194 Query: 218 GFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQIL 261 G +++DR++ + G+++ + P FF + QF +I+ Sbjct: 195 GEIIKLSDRIIELDHGKVLRQCTPKEFFGTGLTSAKFQFQGEIM 238 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 290 Length adjustment: 25 Effective length of query: 236 Effective length of database: 265 Effective search space: 62540 Effective search space used: 62540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory