Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate Echvi_1096 Echvi_1096 nitrate transport ATP-binding subunits C and D
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__Cola:Echvi_1096 Length = 294 Score = 134 bits (336), Expect = 4e-36 Identities = 80/227 (35%), Positives = 126/227 (55%), Gaps = 9/227 (3%) Query: 1 MTSVSVRDLSLNFGA----VTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVS 56 M + + ++S +FG V VL +NL + GEF+ ++G SG GK+TL+N + GL Sbjct: 1 MAIIELNNVSKSFGMGASRVDVLSDINLQVAEGEFVAIVGFSGSGKTTLINLLNGLAFPD 60 Query: 57 DGQIFIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVA--KIPPAEIEKRV 114 G++ + + VT P DRG+ +FQ+Y+L P ++V N+ + ++ E + Sbjct: 61 QGEVLLHGQPVTGPGP-DRGV--IFQNYSLLPWLSVYNNVKLAVDEVFPQLSSKEKASHI 117 Query: 115 KRASEILQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRV 174 K+ ++ + P + + P ELSGG RQRV++ RAL + ++ L DEPLS LDA R L+ Sbjct: 118 KKYIGMVNLTPAMDKLPKELSGGMRQRVSVARALAMNPEILLMDEPLSALDALTRGSLQE 177 Query: 175 EIKRLHQSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTI 221 EI R+ K T I +T+D E + +ADRI + G L TI Sbjct: 178 EIIRIWSQDKKTAILITNDVDEGILMADRIIPLTPGPKATLGPEFTI 224 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 294 Length adjustment: 28 Effective length of query: 333 Effective length of database: 266 Effective search space: 88578 Effective search space used: 88578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory