Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate Echvi_2498 Echvi_2498 Predicted ATPase involved in cell division
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__Cola:Echvi_2498 Length = 232 Score = 100 bits (248), Expect = 4e-26 Identities = 69/217 (31%), Positives = 118/217 (54%), Gaps = 23/217 (10%) Query: 26 VKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTSGEIYFEGKDIWKDIKDRESLV 85 +++V+F++++ E V L+G +GSGK++ K + LP G G D+ K+IK ++ V Sbjct: 24 LQDVTFDIEKDEFVFLIGRTGSGKSSLLKTLYADLPLKMGYGKISGYDL-KEIKTKD--V 80 Query: 86 EF-RRKVHAVFQD------PFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESLF 138 F RRK+ VFQD + N ++ + T W+ +K + + E L Sbjct: 81 PFLRRKLGIVFQDFQLFTDRTVAENLYFVMRATGWK----------DKAKMKTRMVEVLM 130 Query: 139 RVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKLLE 198 RVG+ K PHQ+SGG++QR++IAR + P +++ADEPT +D GI KL + Sbjct: 131 RVGLG--GAATKMPHQLSGGEQQRVVIARALLNHPSILLADEPTGNLDPEVADGIFKLFQ 188 Query: 199 ELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVE 235 E+ +QGT+++ TH+ L I + G++++ Sbjct: 189 EI-NKQGTAVLMATHNHDLLNKYPYRILKCEKGKLLD 224 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 232 Length adjustment: 24 Effective length of query: 244 Effective length of database: 208 Effective search space: 50752 Effective search space used: 50752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory