GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Echinicola vietnamensis KMM 6221, DSM 17526

Align Probable 4-aminobutyrate aminotransferase; EC 2.6.1.19; (S)-3-amino-2-methylpropionate transaminase; EC 2.6.1.22; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT (uncharacterized)
to candidate Echvi_0577 Echvi_0577 ornithine aminotransferase

Query= curated2:P94427
         (436 letters)



>lcl|FitnessBrowser__Cola:Echvi_0577 Echvi_0577 ornithine
           aminotransferase
          Length = 413

 Score =  199 bits (506), Expect = 1e-55
 Identities = 125/408 (30%), Positives = 215/408 (52%), Gaps = 45/408 (11%)

Query: 35  KGEGAELYDLDGRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELI--HPGFNVMMYPTY 92
           +GEG  ++D++G ++ DF  +   +N GH HP++++ +  QA  L      F+  +   +
Sbjct: 32  RGEGVFMWDVEGEKYYDFLSSYSAVNQGHCHPRILQTLIDQAGTLTLTSRAFHNDVLGPF 91

Query: 93  IELAEKLCGIAPGSHEKKAIFLNSGAEAVENAVKIARKY-------TKRQGVVSFTRG-F 144
            +   +  G        K + +N+GAE VE A+KIARK+        + +G +   +  F
Sbjct: 92  EKFLTEYFGY------DKVLPMNTGAEGVETAIKIARKWGYEKKGIPENEGTIIVAKNNF 145

Query: 145 HGRTNMTMSMTSKVKPYKFGFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFF 204
           HGRT   +S ++     K  FGP+ P     P               +DD  I A  D  
Sbjct: 146 HGRTTTVISFSNDETARK-NFGPYTPGFVTIP---------------HDD--IDALKDVL 187

Query: 205 IASVAPETVACVVMEPVQGEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTY 264
             S   + +   ++EP+QGE G  +P + +++ VA+ CK+HG++F+ADEIQTG ARTG  
Sbjct: 188 SQS---KNIIGYLVEPIQGEAGVYVPKEGYLKEVAAVCKDHGVLFMADEIQTGIARTGKL 244

Query: 265 FAIEHFDVVPDLITVSKSLAAGL-PLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALA 323
            A +H  V PD++ + K+++ G  P+S V+    +++   PG+ G T+ G+PLG   A+ 
Sbjct: 245 LACDHEGVKPDMLILGKAISGGFYPVSAVLADDHIMEVIQPGQHGSTFGGNPLGAKVAMT 304

Query: 324 VLDIIEEEGLNERSEEIGKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDK 383
            L+++++E L E ++++GK+  ++  +   +   +  +R  G + AI I    DT + D 
Sbjct: 305 ALNVVKDEKLAENADKLGKLFRERIQQLVDKSDLVELVRGKGLLNAIVI---NDTEDSDT 361

Query: 384 TKAAAIAAYANQNGLLLLTAGINGNIIRFLTPLVISDSLLNEGLSILE 431
                +A    +NG  LL    +GNIIRF  PLVI++  L++   I+E
Sbjct: 362 AWRLCLA--LKENG--LLAKPTHGNIIRFAPPLVITEEQLHDCCDIIE 405


Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 473
Number of extensions: 23
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 436
Length of database: 413
Length adjustment: 32
Effective length of query: 404
Effective length of database: 381
Effective search space:   153924
Effective search space used:   153924
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory