Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate Echvi_0738 Echvi_0738 Acyl-CoA dehydrogenases
Query= BRENDA::Q92947 (438 letters) >FitnessBrowser__Cola:Echvi_0738 Length = 452 Score = 229 bits (585), Expect = 1e-64 Identities = 138/380 (36%), Positives = 203/380 (53%), Gaps = 2/380 (0%) Query: 56 LEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGC 115 LE+ L E I R + ++ + P F II +M ELG+ G T KGYGC Sbjct: 73 LEKTLPPHEQEIVAKVRDFMEKEVRPIANEYWNKGHFPMHIIPKMAELGIAGLTYKGYGC 132 Query: 116 AGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLG 175 G S++ G LA E+ RVD+ + VQS L M IY GSEEQ+Q++LP++ K +++G Sbjct: 133 PGHSALLEGFLAMEMARVDTSISTFFGVQSGLAMGSIYVCGSEEQKQEWLPKMQKMDVIG 192 Query: 176 CFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWAR-CEDGCIR 234 FGLTEP GS + T ++ + +NG K WI N+ +D+ V+WAR +D ++ Sbjct: 193 AFGLTEPKVGSGVAGGLTTTCKREGDE-WVINGQKKWIGNATFSDITVIWARDLDDQQVK 251 Query: 235 GFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNAR 294 GF++ K G +I+ K +LR +I M VPE + L A+S L R Sbjct: 252 GFIVRKDNPGFHPEKIENKMALRTVQNALITMKDCRVPESDRLQNANSFKDTSEILRLTR 311 Query: 295 YGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLG 354 G+AW +G A +Y +R QFG P+A QL+Q L ML ++T +L Sbjct: 312 AGVAWQAVGCGRGAYEAALRYTNERKQFGRPIAGFQLVQDLLVTMLGDLTAMQTMVYRLS 371 Query: 355 RLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYE 414 +++D + E SL K + I +R++ GGNGI EY + R + EA+ +YE Sbjct: 372 KMQDAGELKDEHASLAKVFCTLRMRTIVDHSRELFGGNGILLEYDIARFVADAEAIYSYE 431 Query: 415 GTHDIHALILGRAITGIQAF 434 GT +I++LI+GRAITG AF Sbjct: 432 GTKEINSLIVGRAITGHSAF 451 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 452 Length adjustment: 32 Effective length of query: 406 Effective length of database: 420 Effective search space: 170520 Effective search space used: 170520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory