Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate Echvi_0150 Echvi_0150 glutamate-1-semialdehyde-2,1-aminomutase
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Cola:Echvi_0150 Length = 429 Score = 139 bits (351), Expect = 1e-37 Identities = 123/420 (29%), Positives = 188/420 (44%), Gaps = 37/420 (8%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P+ I++ EG ++D D N + + + G + +GH+HP + EAI K E T + Sbjct: 35 PLFIKKAEGAYLFDEDDNRYIELINSWGPMILGHNHPEINEAIVKAVENGTSFGAPT--- 91 Query: 97 ENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQ 156 I +AE + ++ P KV NSG EA +A++L + TGR +FL F +HG Sbjct: 92 AKEIDIAELICKMVPS--VEKVRMVNSGTEATMSAVRLARGYTGRDKFLKFEGNYHGHGD 149 Query: 157 AVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVF 216 + L S + P PGVT D P N V + +E Sbjct: 150 SFLIAAGSGAMTMGA--PNSPGVT---------KGTAKDTLLAPYNDLNAVKEVLE---- 194 Query: 217 RHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFW 276 E+ AI EP+ G G V+P +GF + L+K DE GI+L DEV G R + Sbjct: 195 --ANRDEVAAIILEPVPGNMGLVLPNEGFLQGLRKLCDEEGIVLIFDEVMTGF-RLAQGG 251 Query: 277 AIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADI----TFDKPGRHATTFGGNPVAIAAGI 332 A E FGV PDL GK IGGG+P+ + +I + P A T GNP+A+AAG Sbjct: 252 AQEVFGVTPDLTTMGKIIGGGMPVGAYGGKKEIMDFVSPVGPVYQAGTLSGNPIAMAAGF 311 Query: 333 EVVEIV---KELLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEK 389 +++ + E+ + + G L ++ EK + LG ++ K K + Sbjct: 312 AMLDHLYQHPEVYQQLDQAGSKLVAGVKSSVEKLGLEYTMTHLGSMYSLFFTKEKVVDFE 371 Query: 390 YPELRDRIV-----KESAKRGLVLLGCGDNSIRFIPPLIVTKEEIDVAMEIFEEALKAAL 444 + D ++ + KRG+ L S+ L T E ID ++ E +L+ L Sbjct: 372 TAKTSDTVLFGKYFQAMLKRGVYLPPSQFESLFLSTAL--TDEHIDQIIDANEASLREIL 429 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 429 Length adjustment: 32 Effective length of query: 413 Effective length of database: 397 Effective search space: 163961 Effective search space used: 163961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory