GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoD in Echinicola vietnamensis KMM 6221, DSM 17526

Align Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 (characterized)
to candidate Echvi_0304 Echvi_0304 purine nucleoside phosphorylase I, inosine and guanosine-specific

Query= SwissProt::P77834
         (274 letters)



>lcl|FitnessBrowser__Cola:Echvi_0304 Echvi_0304 purine nucleoside
           phosphorylase I, inosine and guanosine-specific
          Length = 282

 Score =  252 bits (644), Expect = 6e-72
 Identities = 129/264 (48%), Positives = 174/264 (65%)

Query: 6   IEQAAQFLKEKFPTSPQIGLILGSGLGVLADEIEQAIKIPYSDIPNFPVSTVEGHAGQLV 65
           I  A  ++ E+ P  P++G+ILG+GLG L D+IE    + Y DIP FP+STVE HAG+LV
Sbjct: 14  ITAAVTYISEQHPFIPEVGIILGTGLGQLIDKIEVEASLSYKDIPCFPISTVETHAGELV 73

Query: 66  YGQLEGATVVVMQGRFHYYEGYSFDKVTFPVRVMKALGVEQLIVTNAAGGVNESFEPGDL 125
            G L G  +V M+GRFHYYEGY    VTFPVRVM+ LG++QLIV+NAAGG++ +FE GD+
Sbjct: 74  LGTLHGVPIVAMKGRFHYYEGYDMKAVTFPVRVMRQLGIKQLIVSNAAGGLDPAFEVGDV 133

Query: 126 MIISDHINNMGGNPLIGPNDSALGVRFPDMSEAYSKRLRQLAKDVANDIGLRVREGVYVA 185
           M+I+DHI+    NPL G N    GVRFPDMSE Y +   + A  VA   G++V +GVY  
Sbjct: 134 MLINDHIDLFPENPLRGKNLDDFGVRFPDMSEPYDQGWLEAAVRVAKQEGIKVHQGVYAG 193

Query: 186 NTGPAYETPAEIRMIRVMGGDAVGMSTVPEVIVARHAGMEVLGISCISNMAAGILDQPLT 245
             GP  ET AE R +R +G DAVGMSTVPEVIVAR   + VL +S I+++ +    + ++
Sbjct: 194 VQGPNLETKAEYRYLRTIGADAVGMSTVPEVIVARQMELPVLAMSAITDLCSPGKVKKIS 253

Query: 246 HDEVIETTEKVKADFLRFVKAIVR 269
             EVI      +    R + +++R
Sbjct: 254 IQEVIAAAAIAEPKMTRIIASLIR 277


Lambda     K      H
   0.319    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 238
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 274
Length of database: 282
Length adjustment: 25
Effective length of query: 249
Effective length of database: 257
Effective search space:    63993
Effective search space used:    63993
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate Echvi_0304 Echvi_0304 (purine nucleoside phosphorylase I, inosine and guanosine-specific)
to HMM TIGR01700 (purine nucleoside phosphorylase I, inosine and guanosine-specific (EC 2.4.2.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01700.hmm
# target sequence database:        /tmp/gapView.9942.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01700  [M=249]
Accession:   TIGR01700
Description: PNPH: purine nucleoside phosphorylase I, inosine and guanosine-specific
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                            Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                            -----------
   8.6e-101  322.5   0.2   9.8e-101  322.3   0.2    1.0  1  lcl|FitnessBrowser__Cola:Echvi_0304  Echvi_0304 purine nucleoside pho


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cola:Echvi_0304  Echvi_0304 purine nucleoside phosphorylase I, inosine and guanosine-specific
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  322.3   0.2  9.8e-101  9.8e-101       2     248 ..      31     276 ..      30     277 .. 0.98

  Alignments for each domain:
  == domain 1  score: 322.3 bits;  conditional E-value: 9.8e-101
                            TIGR01700   2 iaiilGsGlGelaekvedavildyseiPefpestveGhkGklvfGklegkkvvilqGrfhlyegydlakvtfPv 75 
                                          ++iilG+GlG+l++k+e +  l y++iP fp stve h+G+lv+G+l+g+++v+++Grfh+yegyd++ vtfPv
  lcl|FitnessBrowser__Cola:Echvi_0304  31 VGIILGTGLGQLIDKIEVEASLSYKDIPCFPISTVETHAGELVLGTLHGVPIVAMKGRFHYYEGYDMKAVTFPV 104
                                          89************************************************************************ PP

                            TIGR01700  76 rvlkllGvealvvtnaaGgintefkvGdlmlikdhinllalnPliGpneekfGarfpdmsdaydkelrqkakei 149
                                          rv+++lG+++l+v+naaGg+++ f+vGd+mli+dhi l + nPl+G n ++fG+rfpdms+ yd+ + + a  +
  lcl|FitnessBrowser__Cola:Echvi_0304 105 RVMRQLGIKQLIVSNAAGGLDPAFEVGDVMLINDHIDLFPENPLRGKNLDDFGVRFPDMSEPYDQGWLEAAVRV 178
                                          ************************************************************************** PP

                            TIGR01700 150 akelditlkeGvyvavtGPsyetpaevrllkklGadavGmstvpevivarhcGlrvlglslitnkaagildael 223
                                          ak+ +i++++Gvy +v+GP+ et ae+r l+++GadavGmstvpevivar+  l vl++s it+ +     +++
  lcl|FitnessBrowser__Cola:Echvi_0304 179 AKQEGIKVHQGVYAGVQGPNLETKAEYRYLRTIGADAVGMSTVPEVIVARQMELPVLAMSAITDLCSPGKVKKI 252
                                          *****************************************************************996666666 PP

                            TIGR01700 224 sdheevlevakkakekleklvsalv 248
                                          s  +ev+ +a  a+ k+++++++l+
  lcl|FitnessBrowser__Cola:Echvi_0304 253 S-IQEVIAAAAIAEPKMTRIIASLI 276
                                          6.9******************9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (249 nodes)
Target sequences:                          1  (282 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 11.56
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory