Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate Echvi_1572 Echvi_1572 rhamnulose-1-phosphate aldolase/alcohol dehydrogenase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Cola:Echvi_1572 Length = 702 Score = 108 bits (271), Expect = 2e-28 Identities = 79/249 (31%), Positives = 119/249 (47%), Gaps = 6/249 (2%) Query: 17 VSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLHAG--IADVSKQAQVDQ 74 V+ GA GIG AIA+ A V+I D+NQ +D A + + K G + DV+K + + Sbjct: 449 VTGGAGGIGKAIADKLASEGACVFITDINQERLDGAVATYSKDVGGGAVMDVTKGDDIIK 508 Query: 75 IIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAVPVLKE 134 A K GG+D++VN AG+A + +E+ W+ + QF + V L+ Sbjct: 509 AYKAAALKFGGVDIIVNCAGLA-ISKPIEQTSEQDWDLLQDILVKGQFAVSKAGVETLRA 567 Query: 135 TSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILP-GVVE 193 + II ++S + P Y + K A V + + LAAELG +RVN + P V+E Sbjct: 568 QNLGGDIINIASKNALVSGPNNVGYGTAKAAQVHMSRLLAAELGKDKIRVNVVNPDAVIE 627 Query: 194 GERM--DRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNVTG 251 G ++ RA A GI + Y K+ L ++ VDDIA S TG Sbjct: 628 GSKIWEGEWAKGRAKAYGITVEELPAFYAKRTILNEIIGVDDIANGVFAFVGGHLSKCTG 687 Query: 252 QAISVDGNV 260 ++VDG V Sbjct: 688 NILNVDGGV 696 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 702 Length adjustment: 32 Effective length of query: 231 Effective length of database: 670 Effective search space: 154770 Effective search space used: 154770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory