Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate Echvi_1820 Echvi_1820 Short-chain alcohol dehydrogenase of unknown specificity
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Cola:Echvi_1820 Length = 252 Score = 88.2 bits (217), Expect = 2e-22 Identities = 65/214 (30%), Positives = 103/214 (48%), Gaps = 7/214 (3%) Query: 16 LISGAAAGIGAAIAQAFLDVGANVYIC---DVDPAAIDRARTAHPQLHAGVADVSDCAQV 72 LI+GA +GIG A A + G N+ + A+ + H V DV D A V Sbjct: 6 LITGATSGIGRECAIALSNSGYNIIATGRREERLQALQSKLSPSVDYHYLVFDVRDKAAV 65 Query: 73 DRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPLL 132 D +D +D+LINNAG A +++ DPA+W+ + N+ Y +K +P + Sbjct: 66 DAALDSLPKPWSDIDVLINNAGNAHGLDPIQEGDPADWDAMMDINVKGLLYVSKKVMPGM 125 Query: 133 KETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPGVV 192 + A I+ + S+A + Y Y ASK A+ + K + ++L N+RV I PG+V Sbjct: 126 IDKKAG-HIVNIGSIAAKEVYPNGNVYCASKHAVDAITKGMRLDLTKYNIRVTGIHPGLV 184 Query: 193 EGE---RMDRVISARAESLGIGFDQMKGEYLQKI 223 E E + RA+ + GF+ +K E + I Sbjct: 185 ETEFSLVRFKGDEERAKHVYEGFEPLKPEDIADI 218 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory