Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate Echvi_4610 Echvi_4610 3-oxoacyl-(acyl-carrier-protein) reductase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Cola:Echvi_4610 Length = 248 Score = 114 bits (284), Expect = 3e-30 Identities = 85/254 (33%), Positives = 121/254 (47%), Gaps = 23/254 (9%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVS--------ESALAVFRDKYPGTVATR 63 G LI+G + GIG +A Y + GA V +S E LA F K G R Sbjct: 6 GKTALITGASKGIGRAIALKYAQEGANVAFTFLSSVEKGQALEKELAEFGVKAKGF---R 62 Query: 64 ADVSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYR 123 +D SD E + + G LDVL+NNAG+ + +++ W +NINL + + Sbjct: 63 SDASDFKAAEELVNEVVKEFGALDVLINNAGVTRDNL-LMRMNEEAWDDVMNINLKSCFN 121 Query: 124 FAHHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRV 183 A L + G +++I SV G G A + YAA+K I+G KS+A ELG IR Sbjct: 122 TVKAATRTLMKQKAGSIINITSVVGIKGNAGQANYAASKAGIIGFTKSVALELGSRGIRS 181 Query: 184 NALLPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSP 243 NA+ PG +E E V + + Q + + I +KR E+VA +FL S Sbjct: 182 NAVAPGFIE-----------TEMTEVLDEKTVQGWRDAIPMKRGGQPEEVANACVFLGSD 230 Query: 244 AARNVTGQAISVDG 257 + V+GQ I VDG Sbjct: 231 MSSYVSGQVIQVDG 244 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 125 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 248 Length adjustment: 24 Effective length of query: 238 Effective length of database: 224 Effective search space: 53312 Effective search space used: 53312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory