Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate Echvi_3364 Echvi_3364 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >FitnessBrowser__Cola:Echvi_3364 Length = 255 Score = 115 bits (287), Expect = 1e-30 Identities = 77/246 (31%), Positives = 131/246 (53%), Gaps = 14/246 (5%) Query: 17 VSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFPKLH---AGIA-DVSKQAQV 72 ++ + GIGL+IAE F A A+V IC +Q +DE + + GIA +V + ++ Sbjct: 16 ITGASKGIGLSIAEFFAAAGAKVVICSRHQEHLDEIAKKLYEKGYDIMGIACNVGRPNEL 75 Query: 73 DQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAVPVL 132 Q+++ G +D+LVNNAG G V E ++ + N+ + F + +P L Sbjct: 76 VQLVEKTIEAYGQIDILVNNAGTNPYMGPVHETTLELFDKIMDVNVKAPFELSKLCLPHL 135 Query: 133 KETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILPGVV 192 +++S ASII +SS+ P Y+ +K A+ L K A E G +RVNAI PG++ Sbjct: 136 RKSSQ-ASIINISSIGALSPEPQLGIYSVSKSALHSLTKVCAKEWGQQKIRVNAICPGII 194 Query: 193 EGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNVTGQ 252 + + + + + +K+++++R+ ++IAA+ALFLASPA S ++G Sbjct: 195 K-TNFSKALWGNDQIMDV--------IMKRLAIKRLGKTEEIAALALFLASPAASYISGS 245 Query: 253 AISVDG 258 +VDG Sbjct: 246 IFTVDG 251 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 255 Length adjustment: 24 Effective length of query: 239 Effective length of database: 231 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory