Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate Echvi_2849 Echvi_2849 fructose-bisphosphate aldolase, class II, yeast/E. coli subtype
Query= BRENDA::P0AB71 (359 letters) >FitnessBrowser__Cola:Echvi_2849 Length = 353 Score = 464 bits (1193), Expect = e-135 Identities = 223/349 (63%), Positives = 276/349 (79%), Gaps = 1/349 (0%) Query: 9 KPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASF 68 KPG+ G++++ + + AKE+ FALPAVN + T + NAVLETA KV +PVIVQFSNGGA F Sbjct: 4 KPGIKFGEELKDLLEYAKESEFALPAVNVINTSTANAVLETAKKVNSPVIVQFSNGGAQF 63 Query: 69 IAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGE 128 AGKG+ +D Q A+I GA+SGA HVH+MAE YGVPVILHTDH AKKL+PW+DG+L+AG+ Sbjct: 64 FAGKGLANDKQQ-ASIAGAVSGAMHVHKMAEAYGVPVILHTDHAAKKLIPWVDGMLEAGK 122 Query: 129 KHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDN 188 +++AA KPLFSSHM+DLSEE ++ENIE KYL K+ M LEIELG TGGEEDGVDN Sbjct: 123 EYYAAFKKPLFSSHMLDLSEEPIEENIETSVKYLAEFKKLEMALEIELGVTGGEEDGVDN 182 Query: 189 SHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEY 248 + +D+S LYTQPE+V YAY +L + S FTIAA+FGNVHGVYKPGNV L P IL++SQ+Y Sbjct: 183 TDIDSSKLYTQPEEVAYAYEKLREQSELFTIAAAFGNVHGVYKPGNVSLQPKILKNSQDY 242 Query: 249 VSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANE 308 + +K L ++FVFHGGSGS+ +EI+++ YG +KMNIDTD QWA WEGVL YYK NE Sbjct: 243 ICEKFGLSGKPVSFVFHGGSGSSVEEIREATGYGSIKMNIDTDMQWAFWEGVLKYYKENE 302 Query: 309 AYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAID 357 YLQ QLGNP+G D PNKK YDPRVWLR G+ + + RLE AF LNA+D Sbjct: 303 GYLQTQLGNPEGPDVPNKKKYDPRVWLRKGEENFVKRLEVAFDMLNAVD 351 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 353 Length adjustment: 29 Effective length of query: 330 Effective length of database: 324 Effective search space: 106920 Effective search space used: 106920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Echvi_2849 Echvi_2849 (fructose-bisphosphate aldolase, class II, yeast/E. coli subtype)
to HMM TIGR01520 (fbaA: fructose-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01520.hmm # target sequence database: /tmp/gapView.22366.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01520 [M=357] Accession: TIGR01520 Description: FruBisAldo_II_A: fructose-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-169 549.0 0.6 2.6e-169 548.8 0.6 1.0 1 lcl|FitnessBrowser__Cola:Echvi_2849 Echvi_2849 fructose-bisphosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_2849 Echvi_2849 fructose-bisphosphate aldolase, class II, yeast/E. coli subtype # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 548.8 0.6 2.6e-169 2.6e-169 5 356 .. 3 352 .. 1 353 [] 0.99 Alignments for each domain: == domain 1 score: 548.8 bits; conditional E-value: 2.6e-169 TIGR01520 5 lktgvilgedvaklfevakeekfaiPainvvssetvnaaleaardakspiilqfsnggaafiaGkGvkdeaeka 78 k+g+ ge++++l+e+ake +fa+Pa+nv+ ++t+na+le+a++++sp+i+qfsngga+f+aGkG+ +++++a lcl|FitnessBrowser__Cola:Echvi_2849 3 FKPGIKFGEELKDLLEYAKESEFALPAVNVINTSTANAVLETAKKVNSPVIVQFSNGGAQFFAGKGLANDKQQA 76 689********************************************************************999 PP TIGR01520 79 asiaGaiaaaeyvrsiaekygvpvvlhtdhCakkllpyvdglleadekyfkkegkPlfsshmldlseepieeni 152 siaGa+++a++v+++ae+ygvpv+lhtdh akkl+p+vdg+lea+++y+++ +kPlfsshmldlseepieeni lcl|FitnessBrowser__Cola:Echvi_2849 77 -SIAGAVSGAMHVHKMAEAYGVPVILHTDHAAKKLIPWVDGMLEAGKEYYAAFKKPLFSSHMLDLSEEPIEENI 149 .************************************************************************* PP TIGR01520 153 eiakkylkrmakiklileieiGitGGeedGvdneeadkeelytkPedvekvyeelskispkfsiaaafGnvhGv 226 e+++kyl k+++ leie+G+tGGeedGvdn + d+++lyt+Pe+v ++ye+l++ s f+iaaafGnvhGv lcl|FitnessBrowser__Cola:Echvi_2849 150 ETSVKYLAEFKKLEMALEIELGVTGGEEDGVDNTDIDSSKLYTQPEEVAYAYEKLREQSELFTIAAAFGNVHGV 223 ************************************************************************** PP TIGR01520 227 ykpGnvklrPdiladgqeyvaeklglkeakplsfvfhGGsGstkeeikealsyGvvkvnvdtdtqyaalegild 300 ykpGnv l+P+il+++q+y+ ek gl kp+sfvfhGGsGs++eei+ea yG +k+n+dtd+q+a++eg+l+ lcl|FitnessBrowser__Cola:Echvi_2849 224 YKPGNVSLQPKILKNSQDYICEKFGLS-GKPVSFVFHGGSGSSVEEIREATGYGSIKMNIDTDMQWAFWEGVLK 296 **************************9.9********************************************* PP TIGR01520 301 yvlknedylqsqvGnpkgeekpnkkvydPrvwlreaeksmkarvekaleelnaink 356 y+++ne ylq+q+Gnp+g+++pnkk+ydPrvwlr++e+ +r+e a++ lna+++ lcl|FitnessBrowser__Cola:Echvi_2849 297 YYKENEGYLQTQLGNPEGPDVPNKKKYDPRVWLRKGEENFVKRLEVAFDMLNAVDR 352 ****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.51 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory