Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate Echvi_1280 Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__Cola:Echvi_1280 Length = 318 Score = 226 bits (575), Expect = 8e-64 Identities = 136/308 (44%), Positives = 190/308 (61%), Gaps = 12/308 (3%) Query: 36 LPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSILSI 95 L L++LC+ S+L++ F N + +Q S+N+ ++ GMT VILT GIDLSVGSIL++ Sbjct: 10 LIALIILCLVLSLLSDRFLTLANGWNVMRQVSVNICISVGMTLVILTAGIDLSVGSILAL 69 Query: 96 -SAVVAMLVS-------LMPQLGMLSVPAALL-CGLLFGI--VNGALVAFMKLPPFIVTL 144 AV A L+ L +G + A +L GL FG+ NG + K+PPF+ TL Sbjct: 70 CGAVTASLIKNGIAVEGLNLHIGFAPLGAVILGVGLGFGLGWFNGWTITRFKVPPFVATL 129 Query: 145 GTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLRRTVL 204 LT RGL L I FAF+G G LG+P V I +VA++ + ++T Sbjct: 130 AMLTIARGLTMLWTGGFPINGLGEDFAFLGTGWFLGIPMPVWITAVIVALAVLLTKKTKF 189 Query: 205 GLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYE 264 G +YA+GGN AARLSGI + V + VYA++G LA +GG++ ++RL +A G SYE Sbjct: 190 GRYVYAIGGNERAARLSGINISRVKMTVYAIAGGLAAVGGMIVTSRLDSAQP-NAGISYE 248 Query: 265 LDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAV 324 LDAIAAV++GGTS GG G+I+G ++G +II VL+NGLVLL VS WQ ++KG VI+ AV Sbjct: 249 LDAIAAVVIGGTSLSGGKGTIMGAVLGGIIIGVLNNGLVLLNVSPFWQQVVKGAVILLAV 308 Query: 325 ALDSYRRK 332 +D K Sbjct: 309 VIDKANSK 316 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 318 Length adjustment: 28 Effective length of query: 309 Effective length of database: 290 Effective search space: 89610 Effective search space used: 89610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory