Align Amidohydrolase 2 (characterized, see rationale)
to candidate Echvi_1688 Echvi_1688 Predicted metal-dependent hydrolase of the TIM-barrel fold
Query= uniprot:B2T9V4 (276 letters) >FitnessBrowser__Cola:Echvi_1688 Length = 284 Score = 163 bits (412), Expect = 4e-45 Identities = 96/278 (34%), Positives = 143/278 (51%), Gaps = 7/278 (2%) Query: 3 IDAHQHYWDPARGDYEWLTPELKILYRTFGPEDLKPLRERAGIERTVVVQAAPTIDETRY 62 ID H H WD + +Y WL + IL + + +DL+ RE AG+ ++VQAA ++T + Sbjct: 5 IDTHIHIWDFEKAEYAWLENDTSILKQPYQLKDLEDKREAAGVSEGILVQAANNFEDTNW 64 Query: 63 LLDLARHEPSIAGVVGWVPLLLP--TAPQVIEALAHEPKFKGVRPMLQDLPDDTWIANPD 120 +L+ A I GVVGW+PL+ P TA + + FKGVR ++ D PD W+ P Sbjct: 65 MLENAAAHDWIKGVVGWLPLMDPSATARALEDRYLSNGYFKGVRHLIHDEPDPKWLLQPA 124 Query: 121 LTPAIEALIAHDLAFDAL-IYARHVEPFETFATRFPALRIVVDHGAKPPIRYGRAGYQSW 179 + +++ L H L +D + + H++ A + P L++V DH +PPI+ G + +W Sbjct: 125 VLESLQLLADHHLTYDLVGVLPAHIDTALKVAEKVPELKMVFDHLNQPPIQEG-LHFGAW 183 Query: 180 ADAITRLAQLPHVHCKLSGLVTEASP--GWTEETLHPYVEHLLKSFGPARLMWGSDWPVL 237 + + A+ P H K+SG+ T W + PYVE L +FG R G DWPV Sbjct: 184 GNKMREAAEHPMFHVKISGMGTTTGKPFEWGRYDILPYVEFALDTFGMHRCFCGGDWPVS 243 Query: 238 DLNGDY-LLWHSVANTLLTSLSDAERDAVFGGNAAAFY 274 L G Y W L T L + E+ V NA AFY Sbjct: 244 LLAGSYEYSWKRYREVLDTLLYEKEQGKVLYDNALAFY 281 Lambda K H 0.322 0.139 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 284 Length adjustment: 26 Effective length of query: 250 Effective length of database: 258 Effective search space: 64500 Effective search space used: 64500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory