Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate Echvi_3804 Echvi_3804 Nucleoside-diphosphate-sugar epimerases
Query= BRENDA::A3MUJ4 (312 letters) >FitnessBrowser__Cola:Echvi_3804 Length = 357 Score = 128 bits (321), Expect = 2e-34 Identities = 106/344 (30%), Positives = 151/344 (43%), Gaps = 49/344 (14%) Query: 1 MRIVVTGGAGFIGSHLVDKLVELGYEVVVVD--------NLSSGRREFVNPSAE-----L 47 M+ +VTG AGFIG H+ KL+E G EV+ VD NL GR E S Sbjct: 1 MKYLVTGTAGFIGFHVALKLLERGDEVIGVDSINDYYDVNLKYGRLEASGISRHEIGTGK 60 Query: 48 HVR------------DLKD----YSWGAGIKGDVVFHFAANPEVRLSTTEPIVHFNENVV 91 +VR DL D + A K DVV H AA VR S P + N+ Sbjct: 61 YVRSAVYGNYTFVKFDLADKALLFELMAANKVDVVIHLAAQAGVRYSLEHPDAYVQANIQ 120 Query: 92 ATFNVLEWARQTGVRTVVFASSSTVYGDADVIP-TPEEEPYKPISVYGAAKAAGEVMCAT 150 NVLE RQ V+ +V+ASSS+VYG +P + E P+S+Y A K + E+M T Sbjct: 121 GFLNVLEACRQYPVKQLVYASSSSVYGANKAMPFSTEHAVDHPVSLYAATKKSNELMAHT 180 Query: 151 YARLFGVRCLAVRYANVVGPRLRHGVIYDFIMKLRRNPNVLEVLGDGTQRKSYLYVRDAV 210 Y+ LFG+ +R+ V GP R + R V++V G + + Y+ D V Sbjct: 181 YSHLFGIPTTGLRFFTVYGPWGRPDMAMFLFADAIRKGEVIKVFNYGKMERDFTYIDDIV 240 Query: 211 EATLAAWKKFEEMD-------------APFLALNVGNVDAVRVLDIAQIVAEVLGLRPEI 257 E + K + + AP+ N+GN V+++D + + +G + Sbjct: 241 EGVVRVADKPRKPNPNWHENPTVSTSYAPYKIYNIGNSKPVKLMDYIHELEKAMGKSAQK 300 Query: 258 RLVPSTPDGRGWPGDVKYMTLAVTKLMKLTGWRPTMTSAEAVKK 301 ++P GDV V L TG+RP E VK+ Sbjct: 301 EMMPMQ------AGDVVCTYADVQDLSADTGYRPATPLEEGVKQ 338 Lambda K H 0.320 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 357 Length adjustment: 28 Effective length of query: 284 Effective length of database: 329 Effective search space: 93436 Effective search space used: 93436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory