Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate Echvi_1280 Echvi_1280 Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Cola:Echvi_1280 Length = 318 Score = 145 bits (365), Expect = 2e-39 Identities = 94/273 (34%), Positives = 146/273 (53%), Gaps = 17/273 (6%) Query: 48 IAVGMTFVILSGGIDLSVGSVIAFTGVFLAKVIGD----------FGLSPLLAFPLVLVM 97 I+VGMT VIL+ GIDLSVGS++A G A +I + G +PL A L + + Sbjct: 46 ISVGMTLVILTAGIDLSVGSILALCGAVTASLIKNGIAVEGLNLHIGFAPLGAVILGVGL 105 Query: 98 GCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIP 157 G G F G I K+P F+ TLA + RG++ L + PI A+ Sbjct: 106 GFGLGWFNGWTITRFKVPPFVATLAMLTIARGLTMLWTG-----GFPINGLGEDFAFLGT 160 Query: 158 GGGRLSAMGLLMLAVVV-IGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYML 216 G M + + AV+V + + L +T+FG VYAIGGN +A L GI+ + +Y + Sbjct: 161 GWFLGIPMPVWITAVIVALAVLLTKKTKFGRYVYAIGGNERAARLSGINISRVKMTVYAI 220 Query: 217 STGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQG 276 + GLA + G++ + + AG+ ELDAIA+VVIGGT LSGG GT++G + G I G Sbjct: 221 AGGLAAVGGMIVTSRLDSAQPNAGISYELDAIAAVVIGGTSLSGGKGTIMGAVLGGIIIG 280 Query: 277 LIQTYINFDGTLSSWWTKIAIGILLFIFIALQR 309 ++ + +S +W ++ G ++ + + + + Sbjct: 281 VLNNGLVL-LNVSPFWQQVVKGAVILLAVVIDK 312 Score = 25.4 bits (54), Expect = 0.002 Identities = 25/101 (24%), Positives = 39/101 (38%), Gaps = 20/101 (19%) Query: 216 LSTG-LATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAI 274 LS G + L G V + + G A+ G+ + I +G +L G+G LG G I Sbjct: 61 LSVGSILALCGAVTASLIKNGIAVEGLNLH---IGFAPLGAVILGVGLGFGLGWFNGWTI 117 Query: 275 QGLIQTYINFDGTLSSWWTKIAIGILLFIFIALQRGLTVLW 315 K+ + + + RGLT+LW Sbjct: 118 TRF----------------KVPPFVATLAMLTIARGLTMLW 142 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 331 Length of database: 318 Length adjustment: 28 Effective length of query: 303 Effective length of database: 290 Effective search space: 87870 Effective search space used: 87870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory