Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate Echvi_2941 Echvi_2941 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily
Query= BRENDA::A9CEQ8 (378 letters) >FitnessBrowser__Cola:Echvi_2941 Length = 448 Score = 99.8 bits (247), Expect = 1e-25 Identities = 69/222 (31%), Positives = 107/222 (48%), Gaps = 9/222 (4%) Query: 154 ERRAEGFHACKIKIGFGVEEDLRVIAAVREAIGPDMRLMIDANHGYTVTEAITLGDRAAG 213 E + EG+ K+K+G +++D+R +RE IG DM LM+DAN + V EAI A Sbjct: 219 EAKQEGWKHIKMKVGANLQDDIRRAGIIREEIGEDMYLMMDANQRWEVAEAIENMKELAK 278 Query: 214 FGIDWFEEPVVPEQLDAYARVR-AGQPIPVAGGETWHGRYGMWQALSAGAVDILQPDLCG 272 F W EEP P+ + + + A QPI VA GE R Q + AGA+ I Q D C Sbjct: 279 FNPLWIEEPTSPDDILGHKAIADAVQPILVATGEHCQNRVIFKQLMQAGALQICQIDSCR 338 Query: 273 CGGFSEIQKIATLATLHGVRIVPHVWGTGVQIAAALQFMAAMTPDPVRVNPIEPIMEF-D 331 GG +E I +A + + PH G G + +Q ++ + + + ++E+ D Sbjct: 339 VGGVNENLAIMLIAKKFDIPVCPHAGGVG--LCEYVQHLSMVDYISISGSMEGRVIEYVD 396 Query: 332 RTHNPFRQAVLREPLEAVNGVVTIPDGPGLGIEINRDALTEF 373 H F +P+ G +P PG I++ +L E+ Sbjct: 397 HLHEHF-----IDPVVIKKGRYQVPKLPGYSIQMKAASLEEY 433 Lambda K H 0.321 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 448 Length adjustment: 31 Effective length of query: 347 Effective length of database: 417 Effective search space: 144699 Effective search space used: 144699 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory