Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Echvi_1095 Echvi_1095 nitrate transport ATP-binding subunits C and D
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Cola:Echvi_1095 Length = 272 Score = 181 bits (458), Expect = 2e-50 Identities = 98/241 (40%), Positives = 149/241 (61%), Gaps = 5/241 (2%) Query: 9 VSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLD 68 + +V+ T KG L ++ +R +FV+I+G SGCGKSTLL ++AGL+ + G++ +D Sbjct: 27 LKKVYPTPKGDYV-VLDDLNLSIRKGEFVSIIGHSGCGKSTLLTMIAGLNDISGGKIKVD 85 Query: 69 GAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRE--RGMPEAQQKERAAYFIAKVGLR 126 G PV G +R +VFQS +L PWL+ N+ G+++ AQ+++ Y++ KVGL Sbjct: 86 GTPVIEAGPDRAVVFQSPSLLPWLSALDNVMIGVKQVFPHASRAQKQDICKYYLDKVGLG 145 Query: 127 GFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAER 186 LS GMQQR IARA A PK+LL+DEPFG LD+ TR +Q++LL IW+ E+ Sbjct: 146 ADFDKKAHSLSQGMQQRVGIARAFALKPKLLLLDEPFGMLDSLTRGELQDVLLEIWQREK 205 Query: 187 KTVLFVTHDIDEAIFMANRVAVFSARP-GRIKTELAVDLPHPR-HYTIKTSPEFMDLKAR 244 T + +THD+DE+IF+A+RV + ++ P +I EL + PR + PE+ D + Sbjct: 206 ITAVAITHDVDESIFLADRVIMMTSGPYAKIGDELIIPFERPRVRKAVLEHPEYYDYRGY 265 Query: 245 L 245 L Sbjct: 266 L 266 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 272 Length adjustment: 25 Effective length of query: 234 Effective length of database: 247 Effective search space: 57798 Effective search space used: 57798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory