Align Histidine ammonia-lyase (EC 4.3.1.3) (characterized)
to candidate Echvi_0202 Echvi_0202 histidine ammonia-lyase
Query= reanno::SB2B:6937475 (497 letters) >FitnessBrowser__Cola:Echvi_0202 Length = 508 Score = 429 bits (1103), Expect = e-124 Identities = 233/491 (47%), Positives = 321/491 (65%), Gaps = 5/491 (1%) Query: 3 FRYGVDHLTLETVNGIANGSIQAELCQQAIDKINASRHNVDVMAASDKAI--YGINTGFG 60 +R G +TLE + + + + EL AI++I R +D D+A YGINTGFG Sbjct: 11 YRVGEMPVTLERIYRVVSEGKRLELSSAAIERIQQCRAYLDDKIYKDEAALYYGINTGFG 70 Query: 61 PLCDTQISPAETHLLQKNLLITHAVGVGEPIAKSISKLMLITKVHALSQGFSGIRLDVVE 120 L +I E LQ NLL +HA GVGE + K + +LML+TK+ +LS+G SG++L+ V+ Sbjct: 71 YLQQVRIDRNEIQQLQYNLLQSHACGVGEKVPKELVRLMLLTKIESLSRGHSGVQLETVQ 130 Query: 121 RMLAFIALDLIPVVPEQGSVGASGDLAPLSHLFLPLLGEGEFWQGDKIVPAREALKAHGL 180 R++ F D++PVV QGS+GASGDL+PLSHL LPL+G GE + K+ P+ + L+ G Sbjct: 131 RLVDFYNHDVLPVVYNQGSLGASGDLSPLSHLSLPLIGMGEVYFEGKVCPSAQVLEQFGW 190 Query: 181 EPLELHAKEGLALINGTQFILSHAITALTKMGYLLDLADLAGAMSIEGMQGSQSPFRAEL 240 +P+ L +KEGL+LINGTQF+LS+ + + L ADL A+S++G G+ PF A + Sbjct: 191 QPVTLRSKEGLSLINGTQFMLSYGVHITQRAEALFRWADLIAAISVDGFNGNLQPFNALI 250 Query: 241 HEIRPFAGNIEVAARMRSFFKDSENMASHEDCDRVQDPYSLRCIPQVHGASRNAYNHLKE 300 H IR G ++ AA +R + + SE S E +VQDPYS RCIPQVHGAS++ +K Sbjct: 251 HRIRAHEGQVDTAASLRHYLEGSEIAQSKE--KQVQDPYSFRCIPQVHGASKDTLAFVKG 308 Query: 301 LAEIEMNSVTDNPIVISAE-EAISGGGFHGQPLAMVLDYTSIAAAELGNISDRRCYLLLE 359 E E +SVTDNP + E E +SGG FHGQPLA+ DY +IA AE+G+IS+RR Y LL Sbjct: 309 TFEREADSVTDNPNIFPDEDEILSGGNFHGQPLALAFDYLAIAMAEIGSISERRTYQLLS 368 Query: 360 GLHGLPRLLTTSGGLNSGMMIPQYVTAALVTENKSLCFPPSADSVPTSMGQEDHVSMGSI 419 G GLP L GL+SG+MIPQY A++V+ENK LC P S DS+ +S GQEDHVSMG+ Sbjct: 369 GQRGLPLFLVDDPGLHSGLMIPQYTAASVVSENKQLCTPASVDSIVSSNGQEDHVSMGAN 428 Query: 420 SGRKLNQILGNLEKIFAIELMYAAQAIDFRRPNRCSDIIEQNHALIREKVAKLEEDRLLK 479 K ++L NLEKI AIEL+ AAQA++FRRP R S+I+E+ + R+ V+ +DR+L Sbjct: 429 GATKCLRVLDNLEKILAIELLTAAQALEFRRPARSSEIVERLIGVYRDHVSFNAQDRVLS 488 Query: 480 PDIDAIIALVK 490 DI I ++ Sbjct: 489 VDIKNTIKFLR 499 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 581 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 508 Length adjustment: 34 Effective length of query: 463 Effective length of database: 474 Effective search space: 219462 Effective search space used: 219462 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate Echvi_0202 Echvi_0202 (histidine ammonia-lyase)
to HMM TIGR01225 (hutH: histidine ammonia-lyase (EC 4.3.1.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01225.hmm # target sequence database: /tmp/gapView.17359.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01225 [M=506] Accession: TIGR01225 Description: hutH: histidine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-191 620.7 0.0 9.8e-191 620.5 0.0 1.0 1 lcl|FitnessBrowser__Cola:Echvi_0202 Echvi_0202 histidine ammonia-lya Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cola:Echvi_0202 Echvi_0202 histidine ammonia-lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 620.5 0.0 9.8e-191 9.8e-191 7 495 .. 17 504 .. 12 508 .] 0.97 Alignments for each domain: == domain 1 score: 620.5 bits; conditional E-value: 9.8e-191 TIGR01225 7 sltledleavarekarvelsaaaeeavaksravieeivaedktv..YGvntGFGklasvkidkedlaeLqrnlv 78 +tle +++v+ e++r+els aa e++++ ra +++ + +d++ YG+ntGFG l++v+id+++ ++Lq nl+ lcl|FitnessBrowser__Cola:Echvi_0202 17 PVTLERIYRVVSEGKRLELSSAAIERIQQCRAYLDDKIYKDEAAlyYGINTGFGYLQQVRIDRNEIQQLQYNLL 90 5899******************************9877666653358*************************** PP TIGR01225 79 rsHaaGvGepleeevvRallvlrlnslakGysgvraevlellvallnaevlPvvpekGsvGasGDLAPLahlal 152 +sHa+GvGe++++e+vR++l+++++sl++G+sgv+ e+++ lv++ n++vlPvv ++Gs+GasGDL PL+hl+l lcl|FitnessBrowser__Cola:Echvi_0202 91 QSHACGVGEKVPKELVRLMLLTKIESLSRGHSGVQLETVQRLVDFYNHDVLPVVYNQGSLGASGDLSPLSHLSL 164 ************************************************************************** PP TIGR01225 153 vliGeGeaefegevmdaaeaLaaaglePvtlkakEGlALinGtqlmtalavlalvdaekllesadiaaalslea 226 liG Ge+ feg+v ++a++L++ g +Pvtl++kEGl LinGtq+m +++v +ae+l + ad++aa+s+++ lcl|FitnessBrowser__Cola:Echvi_0202 165 PLIGMGEVYFEGKVCPSAQVLEQFGWQPVTLRSKEGLSLINGTQFMLSYGVHITQRAEALFRWADLIAAISVDG 238 ************************************************************************** PP TIGR01225 227 llgtskafdpdihevrphrgqiavaarlrellagseiaeshkdedrvqDaYslRciPqvhGavldtldqvkevl 300 g ++f++ ih +r+h+gq+++aa+lr++l+gseia+s+ e++vqD+Ys RciPqvhGa +dtl++vk + lcl|FitnessBrowser__Cola:Echvi_0202 239 FNGNLQPFNALIHRIRAHEGQVDTAASLRHYLEGSEIAQSK--EKQVQDPYSFRCIPQVHGASKDTLAFVKGTF 310 ****************************************9..99***************************** PP TIGR01225 301 aiElnsatDnPlvfadegevvsgGnFHgepvAlaldflaiaiaelgaiseRRierlldpalseLppFLaedsGl 374 ++E++s+tDnP +f+de+e+ sgGnFHg+p+Ala d+laia+ae+g+iseRR+ +ll + +Lp FL++d+Gl lcl|FitnessBrowser__Cola:Echvi_0202 311 EREADSVTDNPNIFPDEDEILSGGNFHGQPLALAFDYLAIAMAEIGSISERRTYQLLSGQ-RGLPLFLVDDPGL 383 *********************************************************875.59*********** PP TIGR01225 375 nsGlmiaqytaAaLvsenkaLahPasvDsiptsanqEDHvsmgaaaarkllevvenvrrviaiEllaaaqglef 448 +sGlmi+qytaA++vsenk+L+ PasvDsi +s qEDHvsmga +a k l+v +n+++++aiEll+aaq+lef lcl|FitnessBrowser__Cola:Echvi_0202 384 HSGLMIPQYTAASVVSENKQLCTPASVDSIVSSNGQEDHVSMGANGATKCLRVLDNLEKILAIELLTAAQALEF 457 ************************************************************************** PP TIGR01225 449 rkaektaaelekvyeavRevveeleeDRvlapDleavkellekesle 495 r++ +++ +e+++ R+ v+ ++DRvl+ D+++ ++l+++s+e lcl|FitnessBrowser__Cola:Echvi_0202 458 RRPARSSEIVERLIGVYRDHVSFNAQDRVLSVDIKNTIKFLRDRSVE 504 *****************************************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (506 nodes) Target sequences: 1 (508 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.83 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory