GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdB in Echinicola vietnamensis KMM 6221, DSM 17526

Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate Echvi_3823 Echvi_3823 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit

Query= metacyc::MONOMER-11684
         (327 letters)



>lcl|FitnessBrowser__Cola:Echvi_3823 Echvi_3823
           Pyruvate/2-oxoglutarate dehydrogenase complex,
           dehydrogenase (E1) component, eukaryotic type, beta
           subunit
          Length = 326

 Score =  278 bits (710), Expect = 2e-79
 Identities = 142/324 (43%), Positives = 210/324 (64%), Gaps = 2/324 (0%)

Query: 1   MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE 60
           M  + + +A+  AM EEM RD  VF++GE+V    G +K T G+ ++FG +RV+DTP++E
Sbjct: 1   MREIQFREALREAMSEEMRRDKNVFLMGEEVAEYNGAYKVTQGMLDEFGPDRVIDTPISE 60

Query: 61  SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG 120
              AG+G+GA M G+RPI E    +F + A++QI++ AAK+   S   ++ PIV R P G
Sbjct: 61  GGFAGLGVGAGMNGLRPIIEFMTFNFSLVAIDQIVNSAAKMYAMSGGAYNVPIVFRGPTG 120

Query: 121 GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI 180
                   HS + E  FAN PGLK+V+PS PYDAKGLLKAA+RD+DPV+F E +  Y   
Sbjct: 121 NAGQLGATHSSNFENWFANTPGLKVVVPSNPYDAKGLLKAAIRDDDPVIFMESELMYS-D 179

Query: 181 KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVY 240
           KGEVP  +Y+LPIG AD+KR+G D+T++++G  +  AL+AAE L KDGI A V+DLRTV 
Sbjct: 180 KGEVPEGEYLLPIGVADIKRKGADVTIVSFGKIMKVALEAAEELAKDGIEAEVIDLRTVR 239

Query: 241 PLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAM 300
           P+D   + E+  KT + ++V E     S+ +++A  I ++    LDAP+ R+   DIP +
Sbjct: 240 PIDYATVYESVKKTNRCVVVEEANPISSLATDLAFNIQKNMFDYLDAPVLRVNSMDIP-L 298

Query: 301 PYAPTMEKYFMVNPDKVEAAMREL 324
            YAPT  +  + N  +   A++++
Sbjct: 299 SYAPTYIEATLPNVKRTIEAVKQV 322


Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 306
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 327
Length of database: 326
Length adjustment: 28
Effective length of query: 299
Effective length of database: 298
Effective search space:    89102
Effective search space used:    89102
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory