Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate Echvi_0069 Echvi_0069 Enoyl-CoA hydratase/carnithine racemase
Query= curated2:P24162 (257 letters) >FitnessBrowser__Cola:Echvi_0069 Length = 260 Score = 163 bits (412), Expect = 4e-45 Identities = 96/258 (37%), Positives = 138/258 (53%), Gaps = 4/258 (1%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGE--ARAIVLTGSGRA 58 M Y IR ++ I +DRP V NALN + EL AA +A R +VLTG G A Sbjct: 1 MDYKYIRSSVNNHCQEIAIDRPAVFNALNFEVLEELKAAFDQAAQAETVRCVVLTGGGGA 60 Query: 59 FCSGQDLGDGAAE--GLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAA 116 FCSGQDL + G+ + ++R+ Y PL+ + + P++ +NGAA GAG +LALA Sbjct: 61 FCSGQDLKAVGTDLDGIPFKEIIRKYYNPLIIQMRNLSKPIICKLNGAAVGAGCSLALAT 120 Query: 117 DVVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLI 176 DV+IA++ A + F IGL+ DAG ++LP++VG A +A K+ AEEA R+GL+ Sbjct: 121 DVIIASKEAYLAEMFAHIGLVMDAGSNYFLPKRVGYPLAFELATTGRKVYAEEAERLGLV 180 Query: 177 WEAVPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQS 236 +A+ + +A +K+ L L +EA Q + G Sbjct: 181 NKAIEHSALDETVAQYVEVYVNASGSAIGMIKEMLRKSNGMSLEEVLEMEAVYQEKAGSH 240 Query: 237 ADFREGVQAFLEKRPPHF 254 DF+EGV +FLEKR P F Sbjct: 241 QDFKEGVTSFLEKRKPRF 258 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory