Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate Echvi_0343 Echvi_0343 Enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__Cola:Echvi_0343 Length = 258 Score = 131 bits (329), Expect = 2e-35 Identities = 80/254 (31%), Positives = 141/254 (55%), Gaps = 5/254 (1%) Query: 4 ETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCA 63 E ++ +++G + ++ L+RP+K NALNA ++ L A+ + E+ ++V+II +GK FC+ Sbjct: 3 EHVKFEQKGRIGYVILSRPEKRNALNAAMVSGLQAALDRCEAIETVKVVIIKAEGKVFCS 62 Query: 64 GADITQFNQL---TPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDI 120 GAD+ ++ T E S+ +++ ++ K IA + G+AL GG L CD Sbjct: 63 GADLQDIERMQDNTFDENLADSEGLKKLFLRLYTFPKVVIAQVQGHALAGGCGLVSVCDF 122 Query: 121 RIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNR 180 A A+LG E+ +G P L R +G+G+A E+++TG+ + A++ GL+ Sbjct: 123 AYAVPTAKLGYTEVRIGFVPAM-VLVFLVRKLGEGKAKELLLTGELLVAPAAKEIGLIQE 181 Query: 181 VVPLANLEQETRKLAEK-IAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTE 239 V A L+ +++AE+ I++ S S+AL K+++ D PL L + TE Sbjct: 182 VFEPAALDGAVQEIAERLISQNSGESMALTKKMIAAVQDLPLEEALEYAARMNAKARETE 241 Query: 240 DKKEGVSAFLEKRE 253 D K G++AFL K++ Sbjct: 242 DCKRGIAAFLGKKK 255 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory