GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Echinicola vietnamensis KMM 6221, DSM 17526

Align Dihydrolipoyl dehydrogenase; EC 1.8.1.4; Dihydrolipoamide dehydrogenase; E3 component of branched-chain alpha-keto acid dehydrogenase complex; LPD-Val (uncharacterized)
to candidate Echvi_0722 Echvi_0722 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes

Query= curated2:P54533
         (474 letters)



>lcl|FitnessBrowser__Cola:Echvi_0722 Echvi_0722
           Pyruvate/2-oxoglutarate dehydrogenase complex,
           dihydrolipoamide dehydrogenase (E3) component, and
           related enzymes
          Length = 458

 Score =  238 bits (608), Expect = 2e-67
 Identities = 146/459 (31%), Positives = 238/459 (51%), Gaps = 15/459 (3%)

Query: 5   YDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVYRTAR 64
           YD ++LG G  G   A + ++LGL  A++EK  +GGTC++ GC P+K ++ SA V     
Sbjct: 4   YDAIVLGAGQSGMPLAKKISKLGLSVALIEKRVIGGTCINDGCSPTKTMVSSARVAHIVS 63

Query: 65  EADQFGVETAGVSLNFEKVQQRKQAVVDKLAAGVNHLMKKGK-IDVYTGYGRILGPSIFS 123
            A  FG       ++   V++RK  +V+    G    ++K + ID+      ++G + F 
Sbjct: 64  RAADFGTILPHYRIDQRIVKKRKDHIVELFRGGAEKSLRKNESIDI------LMGSAAFK 117

Query: 124 PLPGTISVERGNGEENDMLIPKQVIIATGSRPRMLPGLE-VDGKSVLTSDEALQMEELPQ 182
               TI +    GE +  +   ++ I TGS PR +P +E +     LTS   +++EE P+
Sbjct: 118 D-SRTIQITSDTGEIS-FISGTKIFINTGSEPR-IPEIEGLADTPYLTSTTIMELEETPE 174

Query: 183 SIIIVGGGVIGIEWASMLHDFGVKVTVIEYADRILPTEDLEISKEMESLLKKKGIQFITG 242
            ++I+GGG IG+E+A M   FG KVT+I+ A+R++  ED ++ KE+  +  ++GI  +  
Sbjct: 175 HLLIMGGGYIGLEFAQMFSRFGSKVTIIDRAERLVHKEDEDVCKEISQIFSEEGIDTLFN 234

Query: 243 AKVLPDTMTKTSDDISIQAEKDGETVTYSAEKMLVSIGRQANIEGIGLENTDI-VTENGM 301
           A+V         D   +  E     +      +LV+ GR  +   +GLENT + +T+ G 
Sbjct: 235 AEV---RKVSYQDGFKLTTETPKGLLDIKGSHLLVATGRIPSSAHLGLENTRVKLTDKGF 291

Query: 302 ISVNESCQTKESHIYAIGDVIGGLQLAHVASHEGIIAVEHFAGLNPHPLDPTLVPKCIYS 361
           I  ++  QT E HIYA+GDV G     H+A H+  IA +H    N       LVP C++ 
Sbjct: 292 IQTDDFLQTSEKHIYALGDVAGSAPFTHIAYHDAHIAFQHAFKENAVSKHERLVPYCVFI 351

Query: 362 SPEAASVGLTEDEAKANGHNVKIGKFPFMAIGKALVYGESDGFVKIVADRDTDDILGVHM 421
            P+   +GL E EA+A G   K GKF     G+ L   E+ GF K+  D ++  ILG  +
Sbjct: 352 DPQLGRIGLNEQEAQAKGIPYKTGKFLMKHAGRTLEVDETRGFFKVQVDPESKKILGATI 411

Query: 422 IGPHVTDMISEAGLAKVLDATPWEVGQTIHPHPTLSEAI 460
           +     ++++   +A V   T   +      HPTL+E++
Sbjct: 412 LSLDGGEILATLQMAMVGGVTYDTIATLPIAHPTLAESL 450


Lambda     K      H
   0.315    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 482
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 474
Length of database: 458
Length adjustment: 33
Effective length of query: 441
Effective length of database: 425
Effective search space:   187425
Effective search space used:   187425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory