Align 2-dehydro-3-deoxygluconokinase (EC 2.7.1.45) (characterized)
to candidate Echvi_3631 Echvi_3631 Sugar kinases, ribokinase family
Query= BRENDA::Q9WXS2 (339 letters) >FitnessBrowser__Cola:Echvi_3631 Length = 331 Score = 230 bits (586), Expect = 4e-65 Identities = 132/340 (38%), Positives = 194/340 (57%), Gaps = 14/340 (4%) Query: 2 KVVTFGEIMLRLSPPDHKRIFQTDSFDVTYGGAEANVAAFLAQMGLDAYFVTKLPNNPLG 61 +V+T GEIM+RLS P H+R ++ +++ YGGAEANVA LA G+ VT PNN +G Sbjct: 4 RVITLGEIMMRLSTPGHERFVSSNQYNIVYGGAEANVAISLANWGISTAHVTAFPNNDIG 63 Query: 62 DAAAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFDWE 121 AA +LR G+ T Y+ R+G+YF+E GA QR SK++YDR S + + DW+ Sbjct: 64 KAALQYLRYAGLDTQYVYFEEGRMGLYFVENGAMQRSSKIIYDRFDSVFANFDGDKIDWK 123 Query: 122 KILDGARWFHFSGITPPLGKELPLILEDALKVANEKGVTVSCDLNYRARLWT-KEEAQKV 180 + GA WFH++GITP + I +A+ A+E GV +S D+NYR LW ++ + Sbjct: 124 AVFKGADWFHWTGITPAISASAAKICTEAVNAASELGVKISGDINYRRNLWQYGKQPLDI 183 Query: 181 MIPFMEYVDVLIANEEDIEKVLGISVEGLDLKTGKLNREAYAKIAEEVTRKYNFKTVGIT 240 M + +V+IA D E + I + + EA K A+E + + T Sbjct: 184 MPDLIAKTNVVIAGLTDFENCMDIHEQ---------DYEAACKKAQEKCPSIEY--ISTT 232 Query: 241 LRESISATVNYWSVMVFENGQPHFSNRYEI-HIVDRVGAGDSFAGALIYGSLMGFDSQKK 299 R SISA+ N S +++ + S Y++ HIVDRVG GD++ LIYG L G D Q Sbjct: 233 HRNSISASHNGLSGVLWNGHELLESKSYDMTHIVDRVGGGDAYMAGLIYGLLEGED-QAA 291 Query: 300 AEFAAAASCLKHTIPGDFVVLSIEEIEKLASGATSGRVER 339 E+A AAS LKH+IPGD ++++E+ +L G G++ R Sbjct: 292 LEYAVAASVLKHSIPGDANFVTVDEVSQLVKGENVGKLLR 331 Lambda K H 0.319 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 331 Length adjustment: 28 Effective length of query: 311 Effective length of database: 303 Effective search space: 94233 Effective search space used: 94233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory