Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate Echvi_2328 Echvi_2328 Nucleoside-diphosphate-sugar epimerases
Query= BRENDA::P9WN67 (314 letters) >FitnessBrowser__Cola:Echvi_2328 Length = 346 Score = 158 bits (399), Expect = 2e-43 Identities = 113/345 (32%), Positives = 166/345 (48%), Gaps = 40/345 (11%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNL----------------EHL 44 M+ LVTG AGFIG L +LL +GH VVG+D+ NL EH Sbjct: 1 MKFLVTGVAGFIGHGLSKKLLQEGHQVVGIDSINDYYDVNLKLARLKDLGIDDAPISEHQ 60 Query: 45 ----ADNSAHVFVEADIVTAD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVI 99 D S FV+ + D ++A+ E R ++V +LAAQ VR S+ +P+ N++ Sbjct: 61 KVASTDKSCFEFVKMKLEDGDEMNALFEAERFDIVVNLAAQAGVRYSLENPRAYVDANIV 120 Query: 100 GTVRLAEAARQTGVRKIVHTSSGGSIYGTPPEYPTPETAPTD-PASPYAAGKVAGEIYLN 158 G V L EA R V+ +V+ SS S+YG + P + D P S YAA K + E+ + Sbjct: 121 GFVNLLEACRHHPVKHLVYASS-SSVYGANKKMPFSTSDNVDHPVSLYAASKKSNELMAH 179 Query: 159 TFRHLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFV 218 T+ HLYG+ + + VYGP P + IF +A+L+GKP +VF G RD+ +V Sbjct: 180 TYSHLYGVPTTGLRFFTVYGPWGRPD---MALFIFTKAILNGKPLKVFNYGKMKRDFTYV 236 Query: 219 DDVVDAFVRVS------------ADVGGG--LRFNIGTGKETSDRQLHSAVAAAVGGPDD 264 DD+V+ R + D+ G FNIG K + A+ A G Sbjct: 237 DDIVEGVYRTALVPPKGQQEGDKEDLSGAPYRLFNIGNSKSVNLMDFIRAIEKATGKEAV 296 Query: 265 PEFHPPRLGDLKRSCLDIGLAERVLGWRPQIELADGVRRTVEYFR 309 E P + GD+ + D+ V G++P + DGV V ++R Sbjct: 297 LEMLPMQPGDVPATYADVSALSEVTGYKPNTRVEDGVANFVNWYR 341 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 346 Length adjustment: 28 Effective length of query: 286 Effective length of database: 318 Effective search space: 90948 Effective search space used: 90948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory