Align predicted periplasmic 3-ketoglycoside hydrolase (DUF1080) (characterized)
to candidate Echvi_2156 Echvi_2156 Domain of Unknown Function (DUF1080).
Query= reanno::Caulo:CCNA_01705 (281 letters) >FitnessBrowser__Cola:Echvi_2156 Length = 293 Score = 187 bits (476), Expect = 2e-52 Identities = 98/245 (40%), Positives = 137/245 (55%), Gaps = 15/245 (6%) Query: 41 GPWRSLFDGKTLNGWTAKVARHPVGENYRQTFVADQGVIRVSYAGYDRFDNQFGHLFHKT 100 G W+SLF+G+ L W K+++H + +NY TF + G+++V Y GY+ FD Q+GH+F+ Sbjct: 41 GGWKSLFNGEDLAHWKVKISKHELEDNYANTFRVEDGMMKVRYDGYEDFDQQYGHIFYDE 100 Query: 101 PFSAYRLRFSYRFLTEGGLPDTPGWARANSGIMFHSQSAESMTVDQPFPVSIEFQLLGKD 160 PFSAY L YRF+ E P GWA NSG M H QS ESM DQ FP+SIE QLLG D Sbjct: 101 PFSAYLLHLEYRFVGEQA-PGGEGWALRNSGAMLHGQSPESMLKDQDFPISIEGQLLGGD 159 Query: 161 GDKPRPTGAVCTPGITITIDGAKVKEHCTPPANGPTIANGTWVQAELEVLPSGEITQKIN 220 G+ R T +CTPG + +DG HC ++ T WV A+ VL + + Sbjct: 160 GEHDRTTSNLCTPGTNVVMDGELFTPHCV-SSSSKTYHGEQWVSADFLVLADSVVQHIVE 218 Query: 221 GVVVHRY-----AGAALDPDDTVAGGAKPYILARGAQPVTGGYIALQSEGAPLEFKDIEI 275 G V Y G +DP D + + + +T GYI+LQSE P++F+ +E+ Sbjct: 219 GDTVMTYYAPQIGGGNVDPVDPA--------VKQDGKLLTEGYISLQSESHPIDFRKVEL 270 Query: 276 QELTP 280 +L P Sbjct: 271 FDLAP 275 Lambda K H 0.318 0.137 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 293 Length adjustment: 26 Effective length of query: 255 Effective length of database: 267 Effective search space: 68085 Effective search space used: 68085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory