Align 6-phosphofructokinase isozyme 1; EC 2.7.1.11 (characterized)
to candidate Echvi_3160 Echvi_3160 6-phosphofructokinase
Query= CharProtDB::CH_024070 (320 letters) >FitnessBrowser__Cola:Echvi_3160 Length = 323 Score = 209 bits (533), Expect = 6e-59 Identities = 115/292 (39%), Positives = 173/292 (59%), Gaps = 1/292 (0%) Query: 2 IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61 IK IGV TSGGD+PGMNAA+ + ++A G+ V G GY GL + +VQL + + + Sbjct: 5 IKHIGVFTSGGDSPGMNAALYAITKTAEVNGINVSGFRKGYEGLIDGDLVQLKSHELQKL 64 Query: 62 INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEM-GFPC 120 +GGT L +AR F + R A++ L IDAL+ IGGDG++ G + +E+ P Sbjct: 65 TQKGGTILKTARSKRFLELEGRKKALQTLNVNKIDALIAIGGDGTFKGLLAFSEICDIPF 124 Query: 121 IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA 180 IG+PGTIDNDI GTDYT+GF +A++T +E ID++RDT+ SH R+ +VEVMGR G + + Sbjct: 125 IGIPGTIDNDISGTDYTLGFDSAVNTAIENIDKIRDTAESHNRVFIVEVMGRDSGYIGIH 184 Query: 181 AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG 240 + + G + +++PE +L+ ++K ++ +V+ + + + E Sbjct: 185 SGLMVGADAILIPESGTDFINLLGKVKNYDSEDAFLIVVSEGDEIGADLVSSKIKEVNPN 244 Query: 241 RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQL 292 + R T LGHIQRGG+P DR+L R+G A+ LL +GI N QL Sbjct: 245 VDLRITKLGHIQRGGNPSALDRMLGIRLGVEAVKSLLQSKKNVMIGILNNQL 296 Lambda K H 0.322 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 323 Length adjustment: 28 Effective length of query: 292 Effective length of database: 295 Effective search space: 86140 Effective search space used: 86140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory