Align periplasmic glucoside 3-dehydrogenase (lacC subunit) (EC 1.1.99.13) (characterized)
to candidate Echvi_1438 Echvi_1438 hypothetical protein
Query= reanno::Pedo557:CA265_RS15340 (194 letters) >FitnessBrowser__Cola:Echvi_1438 Length = 183 Score = 124 bits (311), Expect = 1e-33 Identities = 80/196 (40%), Positives = 110/196 (56%), Gaps = 16/196 (8%) Query: 1 MHRREALKNVAFLLGGAISASTMGVLFESFTLPENEKNFVLYSLEDEKIFAEFADIIVPT 60 M+RREA+K V L G A+S ST+ V F+ E +++ ED ++ A DII+P Sbjct: 1 MNRREAMKGVGLLFGSALSVSTLAV-FQQGCTRSKEAVAGVFTDEDAQLMATIGDIIIPE 59 Query: 61 TKSSAGAKAAGLGKFIPMMMKDCYPAAMQ--TSFAQGFKDLQAKSKKDFGKNYITLTPAE 118 T S GAKA G+G F+ M++DCY + S A G+ + S KDF L+P E Sbjct: 60 TPDSPGAKAVGIGAFMVKMLEDCYSQEDRENVSLALGYFE----SDKDFS----ALSPDE 111 Query: 119 RKKLMIDLRAIALAQKESKSEENKD-LAYFFITARDLTLLGYYSSEIGCTKAREYVLIPG 177 + + DL Q +KS E +D L + ++LTL GY+SSE G T+A Y L+PG Sbjct: 112 QVAAVSDLDG----QVYAKSNELEDGLVRGYKIIKELTLFGYFSSEAGATQALRYELVPG 167 Query: 178 RYDGNAPLKPGQKSWA 193 RYDG LKPG K+WA Sbjct: 168 RYDGCVDLKPGDKAWA 183 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 108 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 183 Length adjustment: 20 Effective length of query: 174 Effective length of database: 163 Effective search space: 28362 Effective search space used: 28362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory