Align periplasmic glucoside 3-dehydrogenase (lacC subunit) (EC 1.1.99.13) (characterized)
to candidate Echvi_1848 Echvi_1848 hypothetical protein
Query= reanno::Pedo557:CA265_RS15340 (194 letters) >FitnessBrowser__Cola:Echvi_1848 Length = 183 Score = 105 bits (261), Expect = 6e-28 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 13/193 (6%) Query: 1 MHRREALKNVAFLLGGAISASTMGVLFESFTLPENEKNFVLYSLEDEKIFAEFADIIVPT 60 M+RR+ALK+ A ++GG + + L T P+ + + +S E+ E D I+PT Sbjct: 3 MNRRDALKSFALMMGGTMVGAN--ALLTGCT-PDKQIEGLDFSPEEIDFLDEIGDTIIPT 59 Query: 61 TKSSAGAKAAGLGKFIPMMMKDCYPAAMQTSFAQGFKDLQAKSKKDFGKNYITLTPAERK 120 T + GAKA G+G F+ MM+KD Y Q F G L+ K++ GK+++ + ER Sbjct: 60 T-DTPGAKAVGIGSFMVMMVKDTYWEEEQKQFIDGLNSLRKGFKEEVGKDFMDASQEERT 118 Query: 121 KLMIDLRAIALAQKESKSEENKDLAYFFITARDLTLLGYYSSEIGCTKAREYVLIPGRYD 180 + L A A + K +F +DLT+LGY++SEIG T+A YV +PG+++ Sbjct: 119 AYLNKLNAAAREENGPK---------YFNMLKDLTVLGYFTSEIGATQALNYVEVPGKWE 169 Query: 181 GNAPLKPGQKSWA 193 K G K+ A Sbjct: 170 PCIDYKKGDKAHA 182 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 105 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 183 Length adjustment: 20 Effective length of query: 174 Effective length of database: 163 Effective search space: 28362 Effective search space used: 28362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory