Align branched-chain amino acid aminotransferase subunit (EC 2.6.1.6; EC 2.6.1.42) (characterized)
to candidate Echvi_0009 Echvi_0009 Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase
Query= metacyc::MONOMER-11904 (286 letters) >FitnessBrowser__Cola:Echvi_0009 Length = 273 Score = 111 bits (277), Expect = 2e-29 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 18/273 (6%) Query: 10 VEKEQAKISVYDHGLLYGDGVFEGIRVYDGVIFKLKEHIDRLFDSATSLQMDIQTSKDEI 69 + E A + D GL+ G VF+ R D L++++DR SA + + +E+ Sbjct: 12 IPSEDASLHPLDIGLIRGYAVFDFFRTVDYHPLFLEDYLDRFIASAAKAHLVLDQGHEEL 71 Query: 70 SKIVIDTIRINELNNAYIRLVITRGVGDLGLDPRKCPKPTIFCIAEPM-NPLLGEDGIKV 128 IV++ I+ N+L IR+V++ G D P K IFC A M + +G+ + Sbjct: 72 KSIVLELIQKNDLKQGGIRMVLSGGNSDNHFSPTK-GSLFIFCEALQMPSDDKYRNGVHL 130 Query: 129 ITSSIRRLPVDVLNPAVKSLNY-LNSILAK-IQANYAGCDEAFLLDSEGYVAEGTGDNIF 186 +T+ R PV P +K+ NY L L+K +AN A E L ++G ++E + NIF Sbjct: 131 LTTEYIR-PV----PEIKTTNYALPVYLSKDWKANNA---EDVLYHADGIISESSRSNIF 182 Query: 187 VIKNGKIKTPPVSSSVLKGITRDAVVDLAKEQGYEIIEEKLTLHDLYVADELFITGTAAE 246 ++K+G I TP +++LKGITR ++ L + +TL ++ ADE+F++ T Sbjct: 183 IVKDGTISTP--KTNILKGITRKNILALVPDAQI----RDITLEEVMAADEVFMSSTTKR 236 Query: 247 LAHVVEIDGRVINNREMGVITKKLSEEFKKIRK 279 + + +ID + I+N +G T L E+FK++ + Sbjct: 237 ILPITKIDHQPISNGAVGTRTTALMEQFKRMEE 269 Lambda K H 0.319 0.140 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 273 Length adjustment: 26 Effective length of query: 260 Effective length of database: 247 Effective search space: 64220 Effective search space used: 64220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory