Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate Echvi_2990 Echvi_2990 Acyl-CoA dehydrogenases
Query= BRENDA::Q18AQ1 (378 letters) >FitnessBrowser__Cola:Echvi_2990 Length = 402 Score = 246 bits (627), Expect = 1e-69 Identities = 138/376 (36%), Positives = 212/376 (56%), Gaps = 7/376 (1%) Query: 2 DLNSKKYQMLKELYVSFAENEVKPLATELDEEERFPYETVEKMAKAGMMGIPYPKEYGGE 61 DL + ++ ++++ F + EV P E ++ FP E V K + G G P +YGG Sbjct: 26 DLFTAEHLLIRQSLRDFVKKEVSPYIEEWAQDAHFPSEIVPKFGEIGAFGPQIPAKYGGG 85 Query: 62 GGDTVGYIMAVEELSRVCGTTGVILSAHTSLGSWPIYQYGNEEQKQKFLRPLASGEKLGA 121 G D + Y + ++E+ R +S SL +PI+ +G+EEQ++KFL LASGE LG Sbjct: 86 GLDYISYGLIMQEIERGDSGMRSTVSVQGSLVMYPIHAFGSEEQREKFLPKLASGEWLGC 145 Query: 122 FGLTEPNAGTDASGQQTTAVLDGDEYILNGSKIFITNAIAGDIYVVMAMTDKSKGNKGIS 181 FGLTEP+ G++ G T+ +GD Y+LNG+K++I+NA DI VV A + N I Sbjct: 146 FGLTEPDHGSNPGGLTTSFKDNGDHYLLNGAKMWISNAPEADIAVVWAKDE----NGRIH 201 Query: 182 AFIVEKGTPGFSFGVKEKKMGIRGSATSELIFEDCRIPKENLL-GKEGQGFKIAMSTLDG 240 IVE+G GF+ K +R S T EL+F++ ++PKENLL GK G + LD Sbjct: 202 GLIVERGMEGFTTPTTHHKWSLRASCTGELVFDNVKVPKENLLPGK--SGLSAPLMCLDA 259 Query: 241 GRIGIAAQALGLAQGALDETVKYVKERVQFGRPLSKFQNTQFQLADMEVKVQAARHLVYQ 300 R GIA A+G A + +Y ER+QF +P++ FQ Q +LA+M ++ A+ L ++ Sbjct: 260 ARYGIAWGAIGAAMDCYESAKRYAMERIQFDKPIAAFQLVQKKLAEMLTEITKAQLLAWR 319 Query: 301 AAINKDLGKPYGVEAAMAKLFAAETAMEVTTKAVQLHGGYGYTRDYPVERMMRDAKITEI 360 KD GK + +MAK A+E+ +A Q+HGG G T DYP+ R M + + Sbjct: 320 LGTLKDQGKATSAQISMAKRNNVAMALEIAREARQIHGGMGITGDYPIMRHMMNLESVIT 379 Query: 361 YEGTSEVQRMVISGKL 376 YEGT ++ +++ ++ Sbjct: 380 YEGTHDIHLLILGQEI 395 Lambda K H 0.315 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 402 Length adjustment: 30 Effective length of query: 348 Effective length of database: 372 Effective search space: 129456 Effective search space used: 129456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory