Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate Echvi_2952 Echvi_2952 Electron transfer flavoprotein, alpha subunit
Query= BRENDA::Q18AQ5 (336 letters) >FitnessBrowser__Cola:Echvi_2952 Length = 321 Score = 169 bits (428), Expect = 9e-47 Identities = 104/326 (31%), Positives = 172/326 (52%), Gaps = 6/326 (1%) Query: 3 NVLVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHYGADEVI 62 ++LV IE E I+ SLE + A+ + + +V+A+ LG+ EG + GA +V+ Sbjct: 2 SILVYIEHAEGTIKKTSLEAVSYASALGEKEGKEVTAVALGAIEEGALAKAGAAGAKKVL 61 Query: 63 VVDDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTG 122 V D+ L + + A +A + A ++ +S+G +A R+S ++ GL ++ Sbjct: 62 HVADDKLNDGVIQAHASAVAQAFEQAGADTLVLAKSSLGDAVAARLSIKLKAGLASNV-- 119 Query: 123 LAVAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFKV 182 +A+ E+ + R + G V ++ + V K++ +A + F+V Sbjct: 120 VALPEEDGGYKVRRSIYTGKAFTDTVITTSNKILAVKKNAVPLKSDG---ADASVEAFQV 176 Query: 183 EFNDADKLVQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGEVSGS 242 ++D ++ K A ++ + +A I+VS GRGM G EN ++ LA+ +G S Sbjct: 177 NLEESDFAAKITATDK-ATDEISLPEADIVVSGGRGMKGPENWHLIENLAKAMGAATGCS 235 Query: 243 RATIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPEAPIF 302 + D+ W VGQTG V P LY+A GISGAIQH+AG+ ++FI+ INK+PEAP F Sbjct: 236 KPVSDSEWRPHHEHVGQTGVKVAPSLYVAVGISGAIQHLAGVNASKFILVINKDPEAPFF 295 Query: 303 KYADVGIVGDVHKVLPELISQLSVAK 328 K AD GIVGD ++LP+L + K Sbjct: 296 KAADYGIVGDAFEILPKLTEAVKAIK 321 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 321 Length adjustment: 28 Effective length of query: 308 Effective length of database: 293 Effective search space: 90244 Effective search space used: 90244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory