Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate Echvi_1687 Echvi_1687 Predicted acyl-CoA transferases/carnitine dehydratase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Cola:Echvi_1687 Length = 380 Score = 164 bits (416), Expect = 3e-45 Identities = 124/399 (31%), Positives = 190/399 (47%), Gaps = 26/399 (6%) Query: 1 MGALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENT 60 M L + ++D S+ L+GP A LAD GA VIKVE+P GD R L + E Sbjct: 1 MPLLEGITIVDFSQFLSGPSASLRLADFGARVIKVEKPKTGDICRQ-----LYVSAVEIA 55 Query: 61 TEAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKA 120 E+ + + NRNK+S T D Q + +L +D+++ NF+ G +A G YD +KA Sbjct: 56 EESTIFHTINRNKESFTADLKEKADQEAIWKLIGAADVVMHNFRPGVMARLGFSYDEVKA 115 Query: 121 INPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDI 180 PQ+IY I+G+GQ GP+A G D ++Q L GL L G+E P +G+++ D+ Sbjct: 116 RFPQIIYAEISGYGQDGPWADLPGQDLLLQSLTGLTFL----NGEEYKAPTPMGISVVDL 171 Query: 181 LTGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTG-NAPKR--LGN 237 L G ILAAL ++ G G + +++L+ + +L G P+R + + Sbjct: 172 LAGTQLAQGILAALYRKEDTGRGSLVQVSMLESAMDFQFEVFTTFLNDGEELPQRSKVNH 231 Query: 238 AHPNI-VPYQDFPTADGDFILTVGND---GQFRKFAEVAGQPQWADDPRFATNKVRVANR 293 H I PY + T DG L +GN G E+A DDP+ ++ R + Sbjct: 232 GHCYIAAPYGVYETKDGFLALAMGNIVTLGDLLACEELA----VFDDPKGWFDR-RDEIK 286 Query: 294 AVLIPLIRQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAG 353 AVL + TT W+ LE A + C + D+ + + Q + ME+ Sbjct: 287 AVLAAHLAN----NTTQHWLDILEPADIWCAKVLDMEAMMEEEGYQVLEMEMEVRTTNGD 342 Query: 354 KVPQVASPIRLSETPVEYRNAPPLLGEHTLEVLQRVLGL 392 ++ PIR++ + P LGEH + L R GL Sbjct: 343 RIRTTRCPIRVNGERILPGRGAPFLGEHN-DALAREFGL 380 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 380 Length adjustment: 31 Effective length of query: 375 Effective length of database: 349 Effective search space: 130875 Effective search space used: 130875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory